KEGG   Mus musculus (mouse): 16538Help
Entry
16538             CDS       T01002                                 

Gene name
Kcns1, Kv9.1
Definition
(RefSeq) K+ voltage-gated channel, subfamily S, 1
  KO
K04931  potassium voltage-gated channel delayed-rectifier subfamily S member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16538 (Kcns1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16538 (Kcns1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 16538
NCBI-ProteinID: NP_032461
MGI: 1197019
Ensembl: ENSMUSG00000040164
Vega: OTTMUSG00000001173
UniProt: O35173 Q3TY49
Position
2; 2 H3
AA seq 497 aa AA seqDB search
MVSEFPGPGSRVPWRPRDEALRVNVGGVRRLLSARALARFPGTRLGRLQAAASEEQARRL
CDDYDAAAHEFYFDRHPGFFLGLLHFYRTGHLHVLDELCVFAFGQEADYWGLGENALATC
CRARYLERRVARPRAWDEDSDAPSSVDPCPDEISDVQRELARYGAARCGRLRRRLWLTME
NPGYSLPSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVAAGRSAEEVRDDPV
LRRLEYFCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGAALGDQRG
ASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVS
VFSGVAYTAEEENEGFHTIPACWWWGTVSMTTVGYGDVVPETVGGKLAASGCILGGILVV
ALPITIIFNKFSHFYRRQKALEAAVRSSGQREFEDLLSSVDGVSDVSLETSRDTSQEGRS
TDLETQAPREPAKSHSY
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcgagtttccgggtccaggctctcgggtcccctggcggcctagagacgaggcg
ctgcgcgtgaacgtgggcggagtgcggcggctgctgagcgcgcgcgcccttgcgcgcttc
ccgggcacgcgcctgggccgcctacaggcggcggcgtccgaggagcaggcgcggcgcctg
tgcgacgactacgacgcagcggcgcacgagttctactttgatcggcatccgggcttcttt
ctcggcctcctacacttctaccgcaccgggcacctgcacgtcctagacgagctgtgcgtc
ttcgccttcggccaggaggctgactactggggcctgggcgagaacgcgctggccacgtgc
tgccgcgcgcggtatctggagcggcgtgtggcgcggcctcgcgcctgggacgaggacagc
gacgcgccgagcagcgtggacccgtgtcccgacgagatctcggacgtgcagcgggagctg
gcgcgctatggtgcggctcgctgtggccgcctgcgccgtcgtctctggctcaccatggag
aatccaggctactcgctgcccagcaagctcttcagctgcgtatccatcggcgtggtgctc
gcctccatcgctgccatgtgcatccacagcctgccggagtaccaagctcgggaggcggcg
gcggcggtggctgcagtggccgcgggtcgcagcgcagaggaggtgcgcgacgacccggtg
ctgcgccgcctggagtacttctgcatcgcttggttcagcttcgaggtgtcgtcgcgcctg
ctgctggctcccagcacgcgcaacttcttctgccacccgctcaacctcattgacatcgtg
tcggtgctgcccttctatctcacactgctggctggcgcagcgcttggtgaccagcgcgga
gccagcggggaggagctcggggacctgggcaaggtagtgcaagtgttccgcctcatgcgc
atcttccgcgtgctcaagctggcgcgccactccacggggctgcgttcgctgggcgccacg
ctcaagcacagctaccgtgaggtgggcatcttactgctgtacctggccgtgggtgtgtca
gtgttctccggcgtggcctacacagccgaagaagaaaacgagggctttcacacaatccct
gcctgctggtggtggggcacagtgagcatgaccacagtgggctatggggatgtggtgcca
gagactgtgggtggcaagctggcggcctcgggctgcatcctcgggggcatcctggtggtc
gccctccccatcaccatcatcttcaacaagttttcccacttctaccggcgccagaaggca
ctggaggcggccgtgcggagcagcggtcagcgcgagtttgaggacttgctgagtagcgtt
gacggggtatcggatgtgtctctggaaacatcccgggacacttctcaggagggacgctct
acagacctggagacccaagctccccgggagcctgcaaaatctcacagttattaa

DBGET integrated database retrieval system