KEGG   Mus musculus (mouse): 16539Help
Entry
16539             CDS       T01002                                 

Gene name
Kcns2, E130006J24Rik, Kv9.2
Definition
(RefSeq) K+ voltage-gated channel, subfamily S, 2
  KO
K04932  potassium voltage-gated channel delayed-rectifier subfamily S member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16539 (Kcns2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16539 (Kcns2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 16539
NCBI-ProteinID: NP_001258633
MGI: 1197011
Ensembl: ENSMUSG00000050963
UniProt: O35174
Position
15; 15 B3.1
AA seq 477 aa AA seqDB search
MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD
DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS
YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP
GYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF
ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESSPTLANLGRVAQVLRLM
RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT
IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccagagcctgtgggatgtgtccgataccgacgtcgaggatggagagatccgc
atcaatgtgggtggcttcaagagacggctgcgttcccatacgctgctgcgcttccctgag
acacgcctgggccgtctgctcctctgccactcgcgagaggccattctggaactctgcgat
gactacgatgacgttcagcgtgagttctacttcgaccgtaaccccgagctcttcccctat
gtgttgcatttctaccacaccggcaagcttcacgtcatggctgagctgtgcgtcttctcc
ttcagccaggagatcgagtactggggtatcaatgagttcttcatcgactcttgctgcagc
tatagctatcacggccgcaaagtggaacctgagcaggagaaatgggacgagcagagtgac
caggaaagcaccacttcctccttcgatgagatcttggccttctataatgatgcttccaag
ttcgatgggcaacccctgggcaacttccgcaggcagctgtggctggcgttggacaaccca
ggctactcagtcctaagcagggtcttcagtgtcctttccatcttggtggtgttgggctcc
atcatcaccatgtgcctcaatagcctgccagacttccaaatccctgatagccagggtaac
cccggtgaagaccccaggttcgaaattgtggagcactttggcattgcttggttcacattt
gagttggtggccaggtttgctgtggcccctgactttcttaagttcttcaagaatgctcta
aaccttattgatctcatgtccattgtcccattttacataactctagtggtgaacctggtg
gtggagagttctcctaccttggctaacttgggcagggtggctcaagtcctgaggctaatg
aggatcttccgaattctcaagctggccagacactccactggcctccgctccttgggagcc
accctgaagtacagctacaaggaagtggggttgctcttgctctacctctcagtggggatt
tccatcttctctgtggtggcctacaccattgaaaaggaggagaacgaaggcctggccacc
atccctgcctgctggtggtgggccactgtcagtatgaccacagttgggtacggagatgtg
gtcccagggacaacagctgggaagttgactgcctctgcctgcatcttggcaggcatcctg
gtggtggtcttgcccatcactttgatcttcaataagttctcccatttctatcggcgccaa
aagcaacttgagagtgctatgcgcagctgtgactttggagatggaatgaaagaggtccct
tcggtcaatttaagggactactatgctcataaagttaagtccctcatggcaagtctgaca
aacatgagtaggagttcacctagtgaactgagtttagatgattctctacattag

DBGET integrated database retrieval system