KEGG   Mus musculus (house mouse): 16541
Entry
16541             CDS       T01002                                 
Symbol
Napsa, KAP, Kdap, NAP1, SNAPA, pronapsin
Name
(RefSeq) napsin A aspartic peptidase
  KO
K08565  napsin-A [EC:3.4.23.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    16541 (Napsa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16541 (Napsa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-
     16541 (Napsa)
Peptidases and inhibitors [BR:mmu01002]
 Aspartic peptidases
  Family A1: pepsin family
   16541 (Napsa)
SSDB
Motif
Pfam: Asp TAXi_N
Other DBs
NCBI-GeneID: 16541
NCBI-ProteinID: NP_032463
MGI: 109365
Ensembl: ENSMUSG00000002204
UniProt: O09043 Q3U7H1
Position
7:44221869..44236270
AA seq 419 aa
MSPLLLLLLCLLLGNLEPEEAKLIRVPLQRIHLGHRILNPLNGWEQLAELSRTSTSGGNP
SFVPLSKFMNTQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPK
ASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDG
ILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVP
PLTFIPVTIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGG
YPFLNGQYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPK
PAGPLWILGDVFLGPYVAVFDRGDKNVGPRVGLARAQSRSTDRAERRTTQAQFFKRRPG
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtcgccactactgctgctgctgctgtgcctgctgctggggaatttggagcctgaggag
gccaaactgatccgtgtccctcttcaacgaatccaccttggacacagaatcttaaaccca
ctgaatggatgggaacagctggcagagctttctaggacctccacctctggtggcaacccc
tcctttgtgcctctctccaagttcatgaacacccagtattttggaactattggtttggga
acgcctcctcagaatttcaccgttgtctttgacacgggttcttccaacttgtgggttccg
tccacgagatgtcatttcttcagtttggcatgctggtttcaccatcgctttaatcccaag
gcctccagctccttcaggcccaatgggaccaagtttgccattcagtatgggaccgggcgg
ctgagcggaatcctgagccaggacaatctgactatcggggggatccacgatgcttttgtg
acatttggagaggctctgtgggagcccagcctgatctttgctttagcccactttgatggg
atcctgggcctcggcttccccactctggctgtgggcggagttcagcctccgctggatgcg
atggtggagcaagggctgctggagaaacccgtcttctccttttacctcaacagggattct
gaagggtctgatgggggagagctggtcctagggggctcagaccccgctcactacgtacct
cccctcaccttcataccagtcaccatccctgcctactggcaggtccacatggagagtgtg
aaggtcggcacagggctgagcctctgtgcccagggctgcagtgccatcctagacacaggc
acatccctcatcacaggacctagtgaggagatccgggccttgaataaagccattggggga
tatcccttcctgaatgggcagtacttcattcagtgttccaagacgccaacgcttccccct
gtctccttccaccttggtggagtctggtttaacctcacaggccaggactatgtcatcaag
attcttcagagcgatgttggcctctgcctgttgggcttccaagccttggatatccccaag
cctgcgggacccctctggatccttggggacgtctttttggggccctatgtggctgtcttt
gaccgtggggacaaaaacgtcggcccgcgcgtgggactggcgcgtgctcagtctcgttca
acagaccgggcagaaagaaggactacgcaggcgcagttcttcaaaagacgccctggttag

DBGET integrated database retrieval system