KEGG   Mus musculus (mouse): 16542
Entry
16542             CDS       T01002                                 

Gene name
Kdr, 6130401C07, Flk, Flk-, Flk-1, Flk1, Krd-1, Ly73, VEGF, VEGFR, VEGFR-2, VEGFR2, orv, sVEGFR-2
Definition
(RefSeq) kinase insert domain protein receptor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16542 (Kdr)
   04014 Ras signaling pathway
    16542 (Kdr)
   04015 Rap1 signaling pathway
    16542 (Kdr)
   04370 VEGF signaling pathway
    16542 (Kdr)
   04020 Calcium signaling pathway
    16542 (Kdr)
   04151 PI3K-Akt signaling pathway
    16542 (Kdr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16542 (Kdr)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    16542 (Kdr)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16542 (Kdr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16542 (Kdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16542 (Kdr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16542 (Kdr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16542 (Kdr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   16542 (Kdr)
CD molecules [BR:mmu04090]
 Proteins
  16542 (Kdr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig V-set VEGFR-2_TMD C2-set_2 Ig_4 Ig_5 TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 16542
NCBI-ProteinID: NP_034742
MGI: 96683
Ensembl: ENSMUSG00000062960
Vega: OTTMUSG00000021297
UniProt: P35918
Position
5 C3.3; 5 40.23 cM
AA seq 1345 aa
MESKALLAVALWFCVETRAASVGLPGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLD
WLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVYV
RDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRIS
WDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSA
GEKLVLNCTARTELNVGLDFTWHSPPSKSHHKKIVNRDVKPFPGTVAKMFLSTLTIESVT
KSDQGEYTCVASSGRMIKRNRTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYP
APDIKWYRNGRPIESNYTMIVGDELTIMEVTERDAGNYTVILTNPISMEKQSHMVSLVVN
VPPQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPGQTSPYAC
KEWRHVEDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERV
ISFHVIRGPEITVQPAAQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPV
CKNLDALWKLNGTMFSNSTNDILIVAFQNASLQDQGDYVCSAQDKKTKKRHCLVKQLIIL
ERMAPMITGNLENQTTTIGETIEVTCPASGNPTPHITWFKDNETLVEDSGIVLRDGNRNL
TIRRVRKEDGGLYTCQACNVLGCARAETLFIIEGAQEKTNLEVIILVGTAVIAMFFWLLL
VIVLRTVKRANEGELKTGYLSIVMDPDELPLDERCERLPYDASKWEFPRDRLKLGKPLGR
GAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLL
GACTKPGGPLMVIVEFCKFGNLSTYLRGKRNEFVPYKSKGARFRQGKDYVGELSVDLKRR
LDSITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASR
KCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVY
TIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDC
WHEDPNQRPSFSELVEHLGNLLQANAQQDGKDYIVLPMSETLSMEEDSGLSLPTSPVSCM
EEEEVCDPKFHYDNTAGISHYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDSQTDSGM
VLASEELKTLEDRNKLSPSFGGMMPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSD
EAGLLKMVDAAVHADSGTTLRSPPV
NT seq 4038 nt   +upstreamnt  +downstreamnt
atggagagcaaggcgctgctagctgtcgctctgtggttctgcgtggagacccgagccgcc
tctgtgggtttgcctggcgattttctccatccccccaagctcagcacacagaaagacata
ctgacaattttggcaaatacaacccttcagattacttgcaggggacagcgggacctggac
tggctttggcccaatgctcagcgtgattctgaggaaagggtattggtgactgaatgcggc
ggtggtgacagtatcttctgcaaaacactcaccattcccagggtggttggaaatgatact
ggagcctacaagtgctcgtaccgggacgtcgacatagcctccactgtttatgtctatgtt
cgagattacagatcaccattcatcgcctctgtcagtgaccagcatggcatcgtgtacatc
accgagaacaagaacaaaactgtggtgatcccctgccgagggtcgatttcaaacctcaat
gtgtctctttgcgctaggtatccagaaaagagatttgttccggatggaaacagaatttcc
tgggacagcgagataggctttactctccccagttacatgatcagctatgccggcatggtc
ttctgtgaggcaaagatcaatgatgaaacctatcagtctatcatgtacatagttgtggtt
gtaggatataggatttatgatgtgattctgagccccccgcatgaaattgagctatctgcc
ggagaaaaacttgtcttaaattgtacagcgagaacagagctcaatgtggggcttgatttc
acctggcactctccaccttcaaagtctcatcataagaagattgtaaaccgggatgtgaaa
ccctttcctgggactgtggcgaagatgtttttgagcaccttgacaatagaaagtgtgacc
aagagtgaccaaggggaatacacctgtgtagcgtccagtggacggatgatcaagagaaat
agaacatttgtccgagttcacacaaagccttttattgctttcggtagtgggatgaaatct
ttggtggaagccacagtgggcagtcaagtccgaatccctgtgaagtatctcagttaccca
gctcctgatatcaaatggtacagaaatggaaggcccattgagtccaactacacaatgatt
gttggcgatgaactcaccatcatggaagtgactgaaagagatgcaggaaactacacggtc
atcctcaccaaccccatttcaatggagaaacagagccacatggtctctctggttgtgaat
gtcccaccccagatcggtgagaaagccttgatctcgcctatggattcctaccagtatggg
accatgcagacattgacatgcacagtctacgccaaccctcccctgcaccacatccagtgg
tactggcagctagaagaagcctgctcctacagacccggccaaacaagcccgtatgcttgt
aaagaatggagacacgtggaggatttccaggggggaaacaagatcgaagtcaccaaaaac
caatatgccctgattgaaggaaaaaacaaaactgtaagtacgctggtcatccaagctgcc
aacgtgtcagcgttgtacaaatgtgaagccatcaacaaagcgggacgaggagagagggtc
atctccttccatgtgatcaggggtcctgaaattactgtgcaacctgctgcccagccaact
gagcaggagagtgtgtccctgttgtgcactgcagacagaaatacgtttgagaacctcacg
tggtacaagcttggctcacaggcaacatcggtccacatgggcgaatcactcacaccagtt
tgcaagaacttggatgctctttggaaactgaatggcaccatgttttctaacagcacaaat
gacatcttgattgtggcatttcagaatgcctctctgcaggaccaaggcgactatgtttgc
tctgctcaagataagaagaccaagaaaagacattgcctggtcaaacagctcatcatccta
gagcgcatggcacccatgatcaccggaaatctggagaatcagacaacaaccattggcgag
accattgaagtgacttgcccagcatctggaaatcctaccccacacattacatggttcaaa
gacaacgagaccctggtagaagattcaggcattgtactgagagatgggaaccggaacctg
actatccgcagggtgaggaaggaggatggaggcctctacacctgccaggcctgcaatgtc
cttggctgtgcaagagcggagacgctcttcataatagaaggtgcccaggaaaagaccaac
ttggaagtcattatcctcgtcggcactgcagtgattgccatgttcttctggctccttctt
gtcattgtcctacggaccgttaagcgggccaatgaaggggaactgaagacaggctacttg
tctattgtcatggatccagatgaattgcccttggatgagcgctgtgaacgcttgccttat
gatgccagcaagtgggaattccccagggaccggctgaaactaggaaaacctcttggccgc
ggtgccttcggccaagtgattgaggcagacgcttttggaattgacaagacagcgacttgc
aaaacagtagccgtcaagatgttgaaagaaggagcaacacacagcgagcatcgagccctc
atgtctgaactcaagatcctcatccacattggtcaccatctcaatgtggtgaacctccta
ggcgcctgcaccaagccgggagggcctctcatggtgattgtggaattctgcaagtttgga
aacctatcaacttacttacggggcaagagaaatgaatttgttccctataagagcaaaggg
gcacgcttccgccagggcaaggactacgttggggagctctccgtggatctgaaaagacgc
ttggacagcatcaccagcagccagagctctgccagctcaggctttgttgaggagaaatcg
ctcagtgatgtagaggaagaagaagcttctgaagaactgtacaaggacttcctgaccttg
gagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggcatcaagg
aagtgtatccacagggacctggcagcacgaaacattctcctatcggagaagaatgtggtt
aagatctgtgacttcggcttggcccgggacatttataaagacccggattatgtcagaaaa
ggagatgcccgactccctttgaagtggatggccccggaaaccatttttgacagagtatac
acaattcagagcgatgtgtggtctttcggtgtgttgctctgggaaatattttccttaggt
gcctccccataccctggggtcaagattgatgaagaattttgtaggagattgaaagaagga
actagaatgcgggctcctgactacactaccccagaaatgtaccagaccatgctggactgc
tggcatgaggaccccaaccagagaccctcgttttcagagttggtggagcatttgggaaac
ctcctgcaagcaaatgcgcagcaggatggcaaagactatattgttcttccaatgtcagag
acactgagcatggaagaggattctggactctccctgcctacctcacctgtttcctgtatg
gaggaagaggaagtgtgcgaccccaaattccattatgacaacacagcaggaatcagtcat
tatctccagaacagtaagcgaaagagccggccagtgagtgtaaaaacatttgaagatatc
ccattggaggaaccagaagtaaaagtgatcccagatgacagccagacagacagtgggatg
gtccttgcatcagaagagctgaaaactctggaagacaggaacaaattatctccatctttt
ggtggaatgatgcccagtaaaagcagggagtctgtggcctcggaaggctccaaccagacc
agtggctaccagtctgggtatcactcagatgacacagacaccaccgtgtactccagcgac
gaggcaggacttttaaagatggtggatgctgcagttcacgctgactcagggaccacactg
cgctcacctcctgtttaa

DBGET integrated database retrieval system