KEGG   Mus musculus (mouse): 16549
Entry
16549             CDS       T01002                                 

Symbol
Khsrp, 6330409F21Rik, Fbp2, Fubp2, K, Ksrp
Name
(RefSeq) KH-type splicing regulatory protein
  KO
K13210  far upstream element-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    16549 (Khsrp)
   03041 Spliceosome [BR:mmu03041]
    16549 (Khsrp)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     16549 (Khsrp)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    16549 (Khsrp)
SSDB
Motif
Pfam: KH_1 KH_2 DUF1897 KH_4
Other DBs
NCBI-GeneID: 16549
NCBI-ProteinID: NP_034743
MGI: 1336214
Ensembl: ENSMUSG00000007670
UniProt: Q3U0V1
Position
17 D; 17 29.63 cM
AA seq 748 aa
MSDYNTGGPPPGPPPPAGGGGGAAGAGGGPPPGPPGAGDRGGGGPGGGGPGGGGASGGPS
QPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNNTPDFGFGGQKRQLEDGDQPD
SKKLASQGDSIGSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQ
ISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM
IPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMV
MDILRERDQGGFGDRNEYGSRVGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFK
QDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGAPGMPPGGRGRGRGQGN
WGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFVIRG
SPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPP
HQYPPQGWGNTYPQWQPPAPHDPNKAAAAATDPNAAWAAYYSHYYQQPPGPVPGPAPAPA
APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVA
TGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQASGNCHPPPP
PFSFQPPATVHPALVGSAGNPFPCGVCP
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtcggactacaacaccggaggtcccccgcccggcccgccgcctcccgctggcggcgga
gggggagccgcgggtgcgggaggaggccctccgccgggcccgccgggcgcgggagaccgg
ggcggcggaggccctggcggcggcggcccgggtggaggaggcgcgtccgggggcccctca
cagcctcccggtggcggcggccctgggatccgcaaggacgccttcgccgacgccgtgcag
cgggcccgccagattgcagccaaaatcggaggtgatgctgctaccaccgtgaataacaac
actcctgattttggctttgggggccaaaagagacagctggaagatggagaccagccagac
agcaagaaactggcttcccagggagactcgattggttctcaactgggacccatccatcct
ccccccaggacctcaatgacagaagagtatagggttccggatggcatggtgggcttgatt
attggcagaggtggtgagcagataaacaaaatccagcaggactcaggctgcaaagttcag
atctcaccagatagtggtggcctccctgagcgcagcgtgtctctgactggagcacctgag
tctgtccaaaaggcaaagatgatgctggatgacatcgtgtctcggggccgtggtggcccc
ccaggacagtttcacgacaacgccaatgggggtcagaatggcacagtgcaggagatcatg
atccctgctggcaaggctggcctggtcattggtaaaggtggagagaccatcaagcagctg
caggagcgggctggggtgaagatgattttaattcaggatggctcccagaacacaaatgtg
gacaagccactgcggattatcggggacccatacaaagtacagcaagcctgtgagatggtg
atggacatcctgcgagaacgtgaccaaggtggctttggggaccgcaatgaatacggatct
cgagttggtggaggcattgatgtgcctgtacccaggcattcagttggtgtagtcattggc
cggagtggagagatgatcaagaagatccagaatgatgccggtgtgcgcatccagttcaag
caagatgatgggaccggccctgagaagattgctcacatcatggggcctccagatcggtgt
gaacacgcagcccggatcatcaatgacctcctccagagtcttcggagtgggcccccgggt
cctccaggggcccctggcatgccccctgggggcaggggccggggccgaggccaaggcaac
tggggccctcctggaggggagatgactttctccattcctacccataagtgtgggctggtc
attggccgaggcggggagaatgtgaaggccattaaccagcagacaggcgcctttgtggaa
atatctcggcagctgccacccaatggggaccccaatttcaagttgtttgtgatccgggga
tcgccccagcagattgaccatgcaaagcagctcattgaggagaagatagagggtcccctc
tgcccagttggaccaggccctgggggaccaggccctgctggacccatggggcctttcaac
cctggacccttcaaccaggggcctccaggggcacccccacatgctggtggtccccctcct
caccagtacccgcctcagggctggggcaatacctacccccagtggcagccacctgcccct
cacgacccaaacaaagctgctgcagcggctacagatcctaatgctgcctgggctgcctac
tactctcactactaccagcaacccccaggtcctgtgccaggccctgccccagcccctgca
gccccacctgcacagggggaacccccccagcctccacccactggccaatcagactacacc
aaggcttgggaagagtattacaaaaaaattggccagcagccccagcagcctggggcaccc
ccacagcaggactacaccaaggcctgggaggagtactacaagaagcaagcacaagtggcc
actggtgggggtcctggagcaccccctggctcccagcctgattacagtgctgcctgggct
gagtattacagacagcaggctgcttactacggacagaccccaggccctggtggcccacag
ccacctcccacccagcagggacagcagcaggcaagtgggaactgccaccctcctcctcct
cctttctccttccaacccccggccaccgtccatcctgccttagtgggtagcgccggaaac
cctttcccctgcggggtgtgcccttga

DBGET integrated database retrieval system