KEGG   Mus musculus (house mouse): 16559
Entry
16559             CDS       T01002                                 
Symbol
Kif17, 5930435E01Rik, AW492270, Kif17b, mKIAA1405
Name
(RefSeq) kinesin family member 17
  KO
K20198  kinesin family member 17
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    16559 (Kif17)
   04812 Cytoskeleton proteins [BR:mmu04812]
    16559 (Kif17)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Kinesin-2 and associated proteins
   16559 (Kif17)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16559 (Kif17)
SSDB
Motif
Pfam: Kinesin Microtub_bd Kinesin_assoc AAA_16 CoA_binding_2 AAA_22
Other DBs
NCBI-GeneID: 16559
NCBI-ProteinID: NP_034753
MGI: 1098229
Ensembl: ENSMUSG00000028758
UniProt: Q99PW8
Position
4:137989562..138029284
AA seq 1038 aa
MASESVKVVVRCRPMNKRERELSCQSVVTVDSARGQCFIQNPGAADEPPKQFTFDGAYYI
EHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPCQRGIIPRAFEH
VFESVQCAENTKFLVRASYLEIYNEDVHDLLGADTKQRLELKEHPEKGVYVKGLSMHTVH
NVAQCERVMETGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVD
LAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHIPYRDSKLTRLLQDSL
GGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPRINEDPKDALLREYQEEIKRL
KAILAQQMGPGNLSALLSTQTPPGPVQSEEKLLSPTTVQQDTEAEKQLIREEYEERLARL
KADYEAEQESRVRLQEDITAMRNSYDVKLSTLQENLRKEKETEAILKAEVLCKTEVMSRA
ELASGPEYSPPLQYETAVKPTILSMPDMPPSGKVTKSQAPLAFEEPHGETSRSEFSFESN
ECSTLEDSATSEAFPGPEEFSNMEFSMAAALTESRYLPEEYLGGQEAAASPLEAERYVQE
NEPSLEPLRILASLQDPFAEVEAKLARLSSTVAMSDSSQTVVPQIPKQPSSADLLEPSDT
KSEADVAVADNVVLGTEPDVNLRVAEEVVSEAETGVWMESEAQVAHVAQVSEEAQPQPLL
AMVSVRRESVGVEVAVLTEEELQPVDQQQVLARLQLLEQQVVGGEQAKNKDLREKHKRRK
RYADERKKQLVAALQNSDEDGGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKD
LQSEFQLEKIDYLATIRRQERDSMLFQQLLEQVQPLIRRDCNYSNLEKIRRESSWDEDNG
FWKIPDPIILKTSLPVVPTGTQNKPARKTSAVDSGEPHMQEEDRYKLMLSRSDSENIASN
YFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALPPTQTPEMPQPRPFRLESLDIP
FSKAKRKKSKNSFGGEPL
NT seq 3117 nt   +upstreamnt  +downstreamnt
atggcctcggagtcagtgaaagtggtcgtgcgctgccgacccatgaacaagcgcgagcgc
gagctgagctgccagtcggtggtgacggtggacagtgcgcgcggccaatgcttcattcag
aacccgggagcggcggacgaacccccaaagcagttcaccttcgatggcgcctactacata
gaacacttcaccgagcagatctacaacgagatcgcctacccgctggtggagggtgtcacc
gaaggctacaatgggaccatttttgcctatggccagacaggcagtgggaagtctttcacc
atgcagggactgccagatcccccctgccagaggggcatcattcccagagccttcgagcac
gtgtttgagagcgttcagtgtgcagagaacaccaagttcttagtgcgggcttcctatctg
gagatctacaacgaagatgtccatgacctgctgggcgctgacaccaagcagaggcttgag
ctgaaggagcatcccgagaagggagtgtatgtcaaggggctgtccatgcacacggtacac
aacgtggcccagtgcgagcgcgtcatggagaccggctggaagaaccgtgcggttggctac
accctgatgaataaggactcctcccgttcccactccatctttaccatcaacatcgagatc
tatgccgtggatgaacggggtaaggaccatcttcgtgcaggcaagctcaacctggtagac
ctggccggcagtgagcggcaatccaagactggggccacaggggaaaggctgaaggaggcc
accaaaattaacctgtcactgtcggcgctgggcaacgtcatctcggcactggtggatggg
cgctgcaagcacattccttaccgggactcgaagctgacccgactgcttcaggactcactg
ggtggcaacaccaagactctgatggtggcttgcctgtctcccgcagacaacaattacgat
gagaccctcagtacgctgcgctatgctaacagggccaagaacatcaagaacaagccacgc
attaatgaagaccccaaggatgccctgcttcgagagtaccaggaagagatcaagaggcta
aaggctatcctcgcccagcagatgggccctggcaacctgtcagccctgctgtccactcag
acacccccaggcccagtccagtctgaggagaagctgctgtccccaactactgtccagcag
gacacggaggctgagaagcagttgatccgagaggagtatgaggagcgcctggcccgcctg
aaggctgactacgaggcagagcaagagtctcgggtccggctgcaggaggacattactgcc
atgcgtaactcgtatgacgtgaagctgtccacactgcaggagaatctgcgcaaggagaag
gagacagaggccattctcaaggcggaagtcctgtgtaagacggaggtcatgtccagggcc
gagttagccagcgggcccgagtactcacctcctttgcagtatgagactgcggtgaagccc
accatcctctccatgcccgacatgccacccagtggcaaggtcaccaagagccaagcgccc
ctcgctttcgaggaaccacacggggagacctccaggtccgagttttcctttgagtccaat
gagtgttccactctcgaagactctgccacatcagaggccttccctgggccagaggagttt
tccaacatggagttctccatggctgcggcactgaccgagagcaggtaccttcctgaggag
tatctcggcggccaggaggctgctgcatctccgctggaggcagagcgctatgtccaggag
aacgagccatcgctggagcccctgcggatactggcaagcctgcaggatccttttgctgaa
gtggaggccaagctggccagactgtcctctactgtggccatgtcggactcatcccagacc
gtcgtcccccagatccctaagcagccatcctcggctgacctgctggagcccagcgacacc
aagtcagaagctgatgtggctgtggctgacaacgtcgtcctcgggactgagcctgatgta
aacctgagagtggctgaggaggtggtttctgaggcagagactggcgtgtggatggagtct
gaagcccaggtggcccatgtggcccaggtgtctgaggaggcccagcctcagcccttgctg
gccatggtgagcgtgaggagggaaagtgtgggtgtagaagtggctgtgttgacggaggag
gagctgcagcctgtggatcaacagcaggtgctggcccgcttgcagttgctggagcagcag
gtggtggggggcgagcaggctaaaaacaaggacctgagggagaagcacaagcggcggaag
cggtacgcagatgagcgcaagaagcagctggtggccgcactgcagaactcggatgaggat
ggcggggactgggtgctgctcaacgtctatgactctatccaggaggaagtgagggccaag
agcaagctgctggagaagatgcagaggaagctccgggcagcagaggtagaaatcaaggac
ctgcagtcagagttccagctggagaagattgattacctggcaaccatccgccggcaggag
cgggactccatgctcttccagcaactcctggagcaggtgcagcctctcatccgcagagac
tgtaactatagcaacctggagaagatcaggcgagagtcgagctgggatgaggataatggc
ttctggaagatcccagatcccatcatactgaaaaccagcctcccagtagttccaactggg
acacagaacaagccagctcgaaaaacctctgcagtagacagtggggagccacacatgcag
gaggaagacaggtataagctgatgctcagccgaagcgacagtgagaatatcgctagcaac
tacttccgctccaagcgggccagccagatcctcagcacggaccccatgaagagcctcaca
tatcacaactcaccaccggggctaaattcctctctgagcaacaactctgccttgccgccc
acccagaccccggaaatgccccagccccggcccttccgcctagagtcccttgacatcccc
ttctccaaagccaagcgtaaaaaaagcaaaaacagcttcggtggtgagcctctgtga

DBGET integrated database retrieval system