KEGG   Mus musculus (house mouse): 16561
Entry
16561             CDS       T01002                                 
Symbol
Kif1b, A530096N05Rik, D4Mil1e, KIF1Bp130, KIF1Bp204
Name
(RefSeq) kinesin family member 1B
  KO
K10392  kinesin family member 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16561 (Kif1b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16561 (Kif1b)
SSDB
Motif
Pfam: Kinesin Kinesin_assoc DUF3694 Microtub_bd KIF1B PH FHA Yop-YscD_cpl PH_3 Tox-ODYAM1
Other DBs
NCBI-GeneID: 16561
NCBI-ProteinID: NP_001277924
MGI: 108426
Ensembl: ENSMUSG00000063077
UniProt: Q60575 Q6PB45 Q3UY61
Position
4:complement(149260776..149392762)
AA seq 1816 aa
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGGKYLKDFQNNKHRYL
LASENQRPGNFSTASMGSLTSSPSSCSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKES
EKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCLFRSERSNTGEVIVTLEPC
ERSETYVNGKRVAHPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQRQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPVPPELLPSEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW
SLDKLKQRLDLMREMYDRAGEVASSAQDDSETTMTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDAMEDFDDEAFVDDTGSDAGTEEGSELFSDGH
DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAP
DYGSGIRQSGTAKISFDNEYFNQSDFSSAAMTRSGLSLEELRIVEGQGQSSEVISPPEEV
NRMNDLDLKSGTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQF
NFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVDYIKTKPIVFEVFGHYQQH
PLHLQGQDLNSPPQPSRRFFPPPMPLSKPVPATKLNTMNKTTLGQSMSKYDLLVWFEISE
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIR
NKPEVDEAAVDAVLSLNIISAKSLKAAHSSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEK
IYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRNLFGSGYSKSPDSNRVTG
IYELSLCKMADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLE
LLHEVEKTRHFLLLRERLGDSVPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITP
SESSGYDSADVESLVDREKELATKCLQLLTHTFNREFSQVHGSISDCKLSDISPIGRDPS
VSSFSSSTLTPSSTCPSLVDSRSSSMDQKTPEANSRASSPCQEFEQFQIVPTVETPYLAR
AGKNEFLNLVPDIEEVRAGSVVSKKGYLHFKEPLSSNWAKHFVVVRRPYVFIYNSDKDPV
ERGIINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAG
TIRSKLSRRCPSQPKY
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgtcgggagcctctgtgaaggtcgctgttcgagtgaggcccttcaattctcgagagacc
agcaaggagtccaagtgcatcattcagatgcaaggcaactcgaccagtattattaaccca
aagaacccaaaggaagcaccaaagtccttcagctttgactactcctactggtcccacacc
tcgcctgaagatccctgttttgcatcgcagaatcgtgtgtacaatgacattggaaaggaa
atgctcttacatgcctttgaaggttataatgtctgtatctttgcctatgggcagactggt
gctgggaaatcctacacgatgatggggaaacaagaagagagccaagctggaatcatccca
cagttgtgtgaagaactctttgagaagatcaatgacaattgtaatgaagaaatgtcttac
tctgtagaggtgagctacatggaaatttactgtgagagagtacgagatttactgaatccc
aaaaacaagggtaacttgcgtgtgcgtgaacacccgcttcttggaccctatgtggaggat
ctgtccaagctggcggtcacctcctacactgacatcgctgacctgatggatgctgggaac
aaagccaggactgtggcagctaccaacatgaatgagacaagcagccgttctcacgctgtg
ttcaccattgtctttacccagaagaaacaggatcctgagacgaacctttctactgagaag
gtcagtaaaatcagcttggtggatctagcaggaagtgaacgggctgattcaactggtgcc
aaaggaactcgattaaaggaaggtgcaaatatcaataagtcccttacaactttgggcaaa
gtcatttcggccttggcagaggtggataactgcacaagcaagagtaaaaagaagaagaaa
actgattttattccttatagggattctgtacttacttggctccttcgagaaaatctcggt
ggcaactcccgaactgcaatggttgctgctctgagcccagccgacatcaactacgatgaa
actttgagcacactgagatacgcagatcgtgcaaaacaaattaaatgcaatgctgttatc
aatgaggacccgaatgccaagctggttcgggagttgaaggaggaagtgacccgactgaag
gaccttcttcgtgctcagggactgggagatattattgatattgacccattgatcgatgat
tactctggaagtggaggcaaatatctgaaagattttcagaacaataagcataggtacttg
ctagcctctgagaatcaacgccctggcaatttttccacagcatccatggggtccctcact
tcatctccatcttcatgctcacttaatagtcaggtgggcttaacatctgtgaccagtatt
caggagaggatcatgtctacacctggaggggaggaagccattgaacgtctgaaggagtca
gagaagatcattgctgagttgaatgaaacctgggaagagaaacttcgtaaaacagaggcc
atcagaatggagagagaagccttgttggctgagatgggagttgccatacgggaagatggg
gggacacttggagttttctctcctaaaaagaccccacatcttgttaacctcaatgaagac
ccattaatgtcggagtgtttgctctattacatcaaggatggaattacaagggttggccag
gcagatgctgagcggcgccaggacatagtgctgagtggggcccacattaaagaggagcat
tgtctctttcggagtgagaggagcaacactggtgaagttattgtgaccttggagccctgt
gagcgctcagaaacatacgtgaatggcaagagggtggctcatcctgttcagctgcgctca
gggaaccgtatcatcatgggtaaaaaccatgtttttcgttttaaccaccctgaacaagcg
cgagcagaaagggaaaagactccctcagctgagaccccctctgagcctgtggactggacc
tttgctcagagagagcttctcgaaaaacaaggaattgatatgaaacaggagatggaaaag
aggcttcaggaaatggagatcctttacaaaaaggagaaggaggaagccgatcttctcctg
gagcagcagagactggactacgagagtaaattgcaggccttgcagaggcaggttgagact
cgatctctggctgcagagacaacggaagaggaggaagaggaggaggaagttccttggaca
cagcatgaatttgagttggcccagtgggcgttccggaaatggaagtctcaccagtttact
tcattaagggacttactctggggcaatgcggtgtacctgaaggaagccaatgccatcagt
gtggaactaaagaaaaaggtgcagttccagtttgttctgctgactgacacgctgtactcc
cctgtgcctcctgaactgcttccctcggagatggagaagacgcacgaggacagacctttc
cctcggactgtggtggcggtggaggtccaggatctgaagaatggagcaacacattattgg
tctttggataaactcaagcagagactggatctgatgcgagagatgtatgacagggcaggg
gaggtggcctccagtgcccaagatgacagcgagacgaccatgaccggcagcgacccattc
tacgatcggttccactggttcaaacttgtgggaagctcccctattttccacggctgtgtg
aatgagcgccttgccgaccgcacaccctcccccactttttccacggccgattccgacatc
actgaactggctgacgagcagcaggatgccatggaggactttgatgatgaggcattcgtg
gatgacaccggctctgacgcagggacggaagagggatcagagctcttcagtgatgggcat
gacccattttacgaccgatccccttggttcattttagtaggaagggcatttgtgtacttg
agcaacctgctgtatccggtgcccctgattcacagggtggccattgtcagtgagaagggg
gaagtccggggatttcttcgtgtggctgtgcaggccattgcagcggatgaagaagcccct
gattatggctctggaatccggcagtcgggaacagctaaaatatcttttgataatgaatac
tttaatcagagtgacttctcgtcagctgcaatgactcgttctggtctgtccttggaggag
ctgaggattgtggaaggtcagggccagagttctgaagtcatcagtcctccagaagaagtc
aatcgaatgaacgacctggatttgaagtcaggcactttgctggatgggaagatggtgatg
gaagggttttctgaagagattggtaaccacctgaagctgggcagtgccttcactttccga
gtcactgtgctccaagccagcgggatccttccagagtatgcagacatcttctgtcagttc
aactttttgcatcggcatgatgaagcgttctccactgaacccctcaagaacaatggaaga
ggaagtcccctgggcttctaccatgtacagaacattgcggtggaggtcacagagtcgttt
gtggactacatcaaaaccaagcccattgtattcgaggtctttgggcactaccagcagcac
ccactccatctgcaaggacaagatcttaacagtccacctcagccatctcggagattcttc
cccccacccatgccactctccaagccagttccagctactaagttaaacaccatgaacaaa
accacccttgggcaaagcatgagcaagtacgaccttctggtttggtttgagatcagtgaa
ctggagcctactggagagtatattccagctgtggttgaccatactgcaggcctgccctgc
caggggacatttttgctgcaccagggcatccagcgacggatcacagtgactatcatccac
gagaagggcagtgagctccactggaaagatgtccgtgagctggtggtaggtcggattagg
aataaaccggaggtagatgaagctgcagttgatgctgttctttccctgaacatcatctct
gctaagtccctgaaggctgcccacagctccagcaggaccttctaccgtttcgaggcagta
tgggacagctccctacataactccctccttctgaaccgagtgacaccctatggagaaaag
atctacatgaccttatctgcttatctggagttggatcattgcatccagccggccgtcatc
actaaggatgtgtgcatggtcttctattcccgagatgccaagatctcaccaccgcgttct
ctgcgaaacctctttggtagtggctactcaaagtcaccagactccaaccgagtgactggg
atctatgagctgagcttatgcaaaatggcagatactggaagcccaggcatgcagaggcgg
aggagaaaagtcttggatacctcagtggcatatgtgcggggagaggagaacctagcgggc
tggcgacctcgtggagacagcctcattctggaacaccagtgggagctggagaagctggag
ctgctgcatgaggtggaaaaaactcgccacttcttgctgcttcgggagagacttggtgac
agcgtccctaagtctctgagtgactcactgtcccccagcctgagcagtggaacccttagc
acctccaccagcatctcctctcagatctcaaccaccacctttgaaagcgccatcacaccg
agcgagagcagtggctacgactcggcagacgttgaaagcctggtcgaccgggagaaagag
ctggctacaaagtgcctgcagcttctcacccacactttcaaccgagaattcagccaggtg
cacggcagcatcagtgactgtaagttgtctgacatctctccaattggacgggacccctct
gtgtccagtttcagcagttccaccctcacgccctcctccacttgcccctccttggtggac
tccaggagcagctctatggatcagaagaccccagaagccaactctcgtgcctccagtccc
tgccaagaatttgaacagtttcagatcgtcccaactgtggagacaccctatttggcccga
gcagggaagaatgaatttctcaatcttgttccagacattgaagaagtcagagcgggatca
gtggtatctaagaaaggatacctgcatttcaaagagccactttccagtaactgggctaaa
catttcgttgtggttcgtcgcccttacgtcttcatctataacagtgacaaagacccagta
gagcgtggcatcattaacctgtctacagcacaggtggagtacagcgaggaccagcaggcc
atggtgaagacacctaatacttttgctgtatgcacaaagcaccgtggggtccttctgcaa
gctctcaatgacaaagacatgaatgactggttatatgcctttaacccacttctggctggc
acaataaggtcaaaactctctcgcagatgcccgagccagccaaagtactga

DBGET integrated database retrieval system