KEGG   Mus musculus (house mouse): 16562
Entry
16562             CDS       T01002                                 
Symbol
Kif1c, B430105J22Rik, D11Bwg1349e, Ltxs1, Orch3
Name
(RefSeq) kinesin family member 1C
  KO
K10392  kinesin family member 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16562 (Kif1c)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16562 (Kif1c)
SSDB
Motif
Pfam: Kinesin Kinesin_assoc Microtub_bd FHA Sigma70_ner
Other DBs
NCBI-GeneID: 16562
NCBI-ProteinID: NP_694743
MGI: 1098260
Ensembl: ENSMUSG00000020821
UniProt: O35071 Q3V3Y9 Q8VI89
Position
11:70591170..70622796
AA seq 1100 aa
MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHT
SVEDPQFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVP
QLCEDLFSRVNVNQSAQLSYSVEVSYMEIYCERVRDLLNPKSRGSLRVREHPILGPYVQD
LSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRSHDQLTGLDSEK
VSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADLQSKKRKSDFIPY
RDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAVINEDPNA
RLIRELQEEVARLRDLLMAQGLSASALGGLKVEEGSPGGVLPPASSPPAPASPSSPPPHN
GELEPSFSPSAEPQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMG
VAVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVDVDIKLTGQFIR
EQHCLFRSIPQPDGEVMVTLEPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHP
EQARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGIDIKLEMEKRLQDLENQYRKEKEE
ADLLLEQQRLYADSDSGEDSDKRSCEESWRLISSLREQLPPTTVQNIVKRCGLPSSGKRR
APRRVYQIPQRRRLQGKDPRWATMADLKMQAVKEICYEVALADFRHGRAEIEALAALKMR
ELCRTYGKPEGPGDAWRAVARDVWDTVGEEEGCGGGGGGSEEGARGAEVEDLRAHIDKLT
GILQEVKLQNSSKDRELQALRDRMLRMERVIPLTQDLEDDNDESGLVTWAPPEGPEAVEE
TVPNDHSPAVRPTSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGAGGRGGG
LRRPPARFVPPHDCKLRFPFKSNPQHRESWPGMGSGEAPAPQPPEEVTVPPAPPNRRPPS
PRRPHRSRRNSLDGGSRSRGGGSTQPEPQHLRPQKHNGYPQQPQPSPAQRPGPRYPPYTT
PPRMRRQRSAPDLKESGAAV
NT seq 3303 nt   +upstreamnt  +downstreamnt
atggctggagcctccgtgaaagttgcagtgagggttcggccctttaatgcccgtgagacc
agccaggatgccaagtgtgtggtcagcatgcagggcaacaccacctccatcattaatccc
aaacagagcaaggatgcccccaaaagcttcaccttcgactattcttactggtcgcatact
tcggtggaggatccgcagtttgcatctcagcagcaggtgtaccgagacataggagaagag
atgctactccatgcctttgaaggctacaatgtgtgcatctttgcctacgggcagacgggg
gctgggaagtcctacaccatgatggggcggcaggagccggggcagcagggcattgtgcct
cagctctgtgaggacctcttctctcgagtcaatgtgaaccagagtgcccagctttcctat
tcagtagaggtgagctatatggaaatctattgcgagcgagtacgagacctcttgaacccc
aagagtcggggctctctgcgggtccgggagcaccccatcctaggcccgtacgtgcaagac
ctgtctaaactggctgtgacttcctatgcagacattgccgacctcatggactgtggaaat
aaggcaagaaccgtggctgccaccaacatgaacgagaccagcagccgctcccatgccgtc
tttactattgtctttacccagcgatcccatgaccagcttactggcctggattcagaaaag
gtcagtaagatcagcttggtggacctcgccgggagtgagcgggctgactcctcaggggcc
cgggggatgcgtctaaaggaaggcgccaacatcaataagtccctgactacgcttgggaag
gtgatctcagccctggcagatttgcaatcaaagaagcggaagtcggatttcatcccctat
agagactcagtgcttacctggctgctcaaggagaatttgggtgggaactctcgcacagca
atgattgcagccctgagtcctgctgacatcaattacgaggagacactcagcactctcagg
tatgcagaccgcaccaagcagatccgatgcaatgctgtcatcaacgaggaccccaatgcc
cggcttatccgggagctgcaggaggaggtggcccggctgcgggacctgctgatggctcag
gggctgtcagcctctgctctaggaggtctaaaggtggaagaggggagtcctggaggtgtt
ctgccccctgcatcatctccccccgccccagcttcaccctcatctcctcccccacataat
ggggagctggagccctcattctcacccagtgccgagccccagattgggcctgaggaggcc
atggagaggctgcaggaaacagagaagatcatagctgagctgaatgagacttgggaggag
aagcttcggaagacagaggctctgagaatggagagagaagcattgctggctgagatgggc
gtggctgtccgggaggatggcggtactgtgggtgtcttctctccaaaaaagactccccac
ctggtaaatctgaatgaggaccccttgatgtctgaatgtcttctctaccacatcaaagat
ggcgtcaccagggttggccaagtagatgtggacatcaagttgactggccagttcatccgg
gagcagcattgcctcttccgcagcatccctcagcctgatggagaagtgatggttactctg
gagccttgtgaaggagctgagacatatgtcaatgggaagctcgtgacggagccgctggtg
ctgaagtcaggaaacaggattgtaatgggcaagaaccatgttttccgcttcaatcacccg
gagcaggcgcggctggaacgagaacgtggggtccccccgcccccaggacctccctcggag
cctgtggactggaactttgctcagaaggagctgctggagcagcaaggcatagacatcaag
ctggagatggagaagaggctgcaggacttggagaatcagtaccggaaagagaaggaagag
gctgaccttctgctggagcagcagcggctgtatgcagactctgacagcggggaagactct
gacaagcgttcttgtgaagaaagctggcggctgatttcctccttgcgggagcagctgccc
cctaccacagtacagaacattgtcaagcgctgtggcctgcctagtagtggcaagcgcagg
gcccctcgaagagtctatcagatccctcagcgacggcggctccagggcaaagacccccga
tgggccaccatggctgacctgaagatgcaggcagtaaaggagatatgctatgaggtggcc
ctagccgacttccgccacggacgagcagaaattgaagccctggctgctctcaagatgagg
gagctgtgccgaacctacggcaagccagagggtcctggagatgcctggagagccgtggcc
agggatgtctgggatactgtgggtgaagaagaaggatgtggaggtggcggaggtggcagt
gaggagggagcccgtggggcagaggtggaggacctccgggctcacatcgacaagctgaca
gggatcctgcaggaggtgaagctccagaacagcagcaaggaccgcgagctgcaggccctg
cgggaccgcatgctccgcatggagagggtcatcccgctgactcaggatcttgaggatgat
aatgacgagtctggtttggtcacctgggccccaccggaagggccagaagcagtagaggag
acagtgcccaacgaccactcaccagctgtccggcccacctcaccacctctgtccagctgg
gagcgggtgtcgagattgatggaagaggaccctgccttccgtcgcggccgccttcgctgg
ctcaagcaggagcagctgcggctgcagggactgcagggcgctgggggccggggtggggga
ctgcgcaggcctccagcccgctttgtgcccccgcatgattgcaagctgcgcttccccttc
aaaagcaaccctcagcacagggagtcctggccaggaatggggagtggagaggccccagct
cctcagccccctgaagaggtcactgtccccccagcaccccctaaccgtaggcctccaagt
ccccgaagaccccaccgttctcgcaggaattccctagatggagggagccgatctcgggga
gggggttctacacagccagaaccccagcacttacggccccaaaagcacaacggttatccc
caacagccccagcccagcccagcccagcggccagggccccgctacccaccatacactacc
cctccgcgaatgcgacggcagcgctcagcccctgacctcaaagagagtggggcagctgtg
tga

DBGET integrated database retrieval system