KEGG   Mus musculus (house mouse): 16564
Entry
16564             CDS       T01002                                 
Symbol
Kif21a
Name
(RefSeq) kinesin family member 21A
  KO
K24185  kinesin family member 21
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16564 (Kif21a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16564 (Kif21a)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    16564 (Kif21a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16564 (Kif21a)
SSDB
Motif
Pfam: Kinesin WD40 Microtub_bd NBCH_WD40
Other DBs
NCBI-GeneID: 16564
NCBI-ProteinID: NP_001102510
MGI: 109188
Ensembl: ENSMUSG00000022629
UniProt: Q9QXL2 Q3UHE7 Q3TQJ5 Q3V416
Structure
Position
15:complement(90817478..90934547)
AA seq 1672 aa
MLGAADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQ
QEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRH
LFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHED
STGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVC
PQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCG
LLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLN
TLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEYKTGKRIIDEEGVESIND
MFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQANQVLARAGEGNEEISNMIH
SYIKEIEDLRAKLLESEAVNENLRKNLTRATARSPYFSASSAFSPTILSSDKETIEIIDL
AKKDLEKLKRKEKKKKKRLQKLEESGREERSVAGKDDNADTDQEKKEEKGVSEKENNELD
VEENQEVSDHEDEEEEEEDEEEEDDIEGEESSDESDSESDEKANYQADLANITCEIAIKQ
KLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVK
CEYEKKLHAMNKELQRLQTAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMK
EEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVR
PMSDKVAGKVTRKLSSSESPAPDTGSSAASGEADTSRPGTQQKMRIPVARVQALPTPTTN
GTRKKYQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELT
KRREKLSKRREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKE
EGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSAT
QNQLLFHMLKEKAELNPELDALLGHALQDLDGAPPENEEDSSEEDGPLHSPGSEGSTLSS
DLMKLCGEVKPKNKARRRTTTQMELLYADSSEVASDTSAGDASLSGPLAPVAEGQEIGMN
TETSGTSARDKELLAPSGLPSKIGSISRQSSLSEKKVPEPSPVTRRKAYEKADKPKAKEH
KHSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHRGI
INPFPACKGVRASPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMS
LGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTS
RTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTGHLGPVMCLTVDQ
ISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRD
NGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEM
RGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQDGQLSDTGDLGEDIASN
NT seq 5019 nt   +upstreamnt  +downstreamnt
atgttgggcgctgcggacgagagctcggtgcgcgtggctgtcagaataagaccacagctt
gccaaagagaagatcgaaggttgccatatctgcacgtcagtcacaccgggagagcctcag
gtcttcctcgggaaggataaggcctttacttttgattatgtgtttgacattgactcccag
caggagcagatctacacccagtgcatcgaaaagctcattgaaggctgttttgaaggctac
aatgccaccgtgtttgcctatggacaaaccggagctgggaaaacctacacgatgggaacc
ggatttgacgtgaacatcatggaggaagagcagggcatcatctctcgtgctgttagacac
ctgttcaagagtattgatgagaaaaagacctcagcgattaaaaacgggctgccccctcct
gaattcaaagtgaatgcccagttcctagagctctataatgaagaggtccttgacttgttt
gataccactcgggatattgatgcaaaaaataaaaaatcaaatataagaattcatgaagat
tcaactggaggaatttatactgtgggcgtcacaacacgcactgtgaatacagaaccggag
atgatgcagtgtctgaagctgggcgctctctcgcgcaccacggccagcacccagatgaac
gtacagagctctcgttcacacgccatctttaccattcacgtgtgtcaaaccagagtgtgt
ccccaaacagatgctgagaacgcaactgataataagctgatctccgaatcgtcgccaatg
aatgagtttgagacgctgacggcgaagtttcactttgttgatctggcgggatcggaaaga
ctgaagagaaccggagctacaggcgagagagcaaaagagggcatttccatcaactgcggg
cttttggctcttgggaatgtaatcagcgccttgggggacaagagcaagagagccacccat
gtcccttacagagactctaagctgacaagactcttgcaggattcccttgggggtaacagc
caaaccatcatgatagcatgcgtcagcccttcagacagggatttcatggagacgttaaac
actctgaagtacgccaatcgagcgagaaatatcaagaacaaggtgatggtcaatcaagac
agagccagtcagcaaatcaacgcgctgcggagcgagatcacgcgccttcagatggagctc
atggaatacaaaaccggtaaaagaataattgacgaggaaggcgtggaaagcatcaatgac
atgtttcatgagaatgctatgctgcagacggaaaataataatctgcgtgtaagaataaaa
gccatgcaggagaccgttgatgcactgagggccagaatcacgcagcttgtcagtgagcag
gccaaccaagttcttgcccgagcaggtgaagggaacgaagagatcagtaatatgattcat
agttatatcaaagaaattgaagacctcagggcaaaattattagaaagtgaagcagtgaac
gagaaccttcggaagaacttgaccagagccacggcgagatctccttacttcagtgcctcc
tcagctttctcgcctactatactgtcttcagacaaggagactatcgaaattatagatcta
gcaaagaaagacttggagaagctaaaacggaaagagaagaagaagaagaaaaggctacag
aaacttgaggaaagcggtcgagaagaaagaagtgttgccgggaaagacgataatgcagac
actgaccaggagaagaaagaagaaaagggtgtttcagagaaagaaaacaatgagctagac
gtggaagagaatcaagaagtgagtgaccacgaggatgaggaagaggaggaagaggacgag
gaggaagaggatgacattgaaggagaagaaagctctgatgaatcagattccgaatctgat
gaaaaagctaactatcaagccgacttagcaaatatcacctgcgagattgcgattaagcag
aagctgatcgacgaactggagaacagccagaaacggctgcagaccctgaaaaagcagtac
gaggagaagctgatgatgctccaacataagatccgggacacgcagctggagagggaccag
gtgctccagaacctaggctcggtggagtcatactcggaagaaaaggccaagaaagtgaag
tgcgaatatgagaagaagctccacgccatgaacaaagagctgcagcgactgcagacggcc
caaaaggagcacgccaggctcctcaaaaaccagtctcagtatgaaaagcagctcaagaaa
ctgcagcaagacgtcatggaaatgaagaaaaccaaggttcgtctaatgaagcagatgaaa
gaagagcaggagaaagcccggctgacagaatctcgaaggaaccgggaaatcgctcagctg
aagaaggatcagcgcaagcgagatcatcaacttagacttctagaggcccagaaaagaaat
caagaagtagttctgcgacgcaaaacggaagaggttacagctctccgcaggcaagtgagg
cccatgtctgataaagtagcgggaaaagttactcggaagctgagctcatccgaaagcccc
gctccggacacaggttccagtgcggcttccggggaagcagacacatcacggccaggcacc
cagcagaaaatgaggatccccgtggcaagagtccaggcattaccaacacctacaacaaat
ggcaccaggaaaaaatatcagaggaaaggattcactggccgggtgttcacttccaagaca
gcccgcatgaagtggcagctactggagcgccgggtgaccgacatcatcatgcagaaaatg
accatctccaacatggaggcggacatgaacagactcctcaggcaacgggaagaactcaca
aaaaggcgagagaaactttctaaaaggagagagaagatagtcaaggagagcggagaggga
gataaaagtgtggctaacatcatcgaggagatggagtccctgacagccaacatagattac
atcaatgatagcattgccgactgtcaagccaacatcatgcagatggaggaggcaaaggaa
gaaggggagacattggatgtcaccgctgtcattaatgcctgtacactgacagaagctcgg
tacctgctagatcacttcctgtcaatgggcatcaataagggtctgcaggctgcccagaaa
gaggctcaaattaaagtcctcgagggtcgactcaaacagaccgaaatcaccagtgcaacc
cagaaccaactcttattccatatgctgaaggagaaggcagagctaaacccagagctggat
gccttgctaggccacgcactgcaagatctagatggcgccccaccagaaaacgaggaggac
agcagcgaggaagatggccctttacacagcccggggtcggagggaagcacgttatcttca
gaccttatgaagctttgtggtgaagtgaaaccaaagaacaaggctcgaaggagaaccacc
actcagatggagttgctgtatgcagatagcagtgaagtagcctcagacactagtgcagga
gatgcctccttgtctggccctctggcacctgttgcagaagggcaggagattggaatgaac
acagagacaagtggtacttctgctagggacaaagagcttcttgccccatctggcttacct
tctaagataggcagcatttccagacagtcatctctatcagaaaaaaaagtgccagagcct
tcccctgtaacaaggagaaaggcatatgagaaggcagataaaccaaaggcgaaggaacat
aaacactcagattcgggcgcttccgagactagtctctcacctccttcctccccaccaagc
cggccccgtaacgaactgaatgtgtttaatcgccttactgtgcctcagggaaccccgtca
gttcagcaggataagtctgatgaaagtgactcctctttgtccgaggtgcacagaggcata
atcaacccatttcctgcctgcaaaggagtcagagcctctcctcttcagtgcgttcacata
gctgaagggcacaccaaggctgtgctctgtgtggattctacggatgatcttctcttcacc
ggatcaaaagatcgcacttgtaaagtatggaatctcgtgactggacaggaaattatgtcc
ctgggggttcaccctaacaacgtggtgtctgtaaaatactgtaattataccagtctggtc
ttcaccgtgtcgacatcttatattaaggtgtgggatatcagagagtcagcaaaatgcatt
cgaacattaacatcttcaggtcaagttacccttggagaagcgtgttctgccagcaccagc
cggacagtagctattccttccggggagagccagatcaatcaaattgcactaaacccaact
ggcactttcctctacgcggcctctggaaatgccgtcagaatgtgggaccttaaaaggttt
cagtctacaggaaagctaaccggacacctgggtcctgttatgtgccttacggtagaccag
atctccaatggacaggacctcatcatcactggctcaaaagaccactacatcaaaatgttc
gatgtgactgaaggggctcttggaactgtaagtcccacccacaacttcgagcctcctcat
tatgatgggatagaagcactggccattcaaggcgataacctattcagtgggtccagagat
aatggaatcaagaaatgggacttagctcagaaaggtcttcttcagcaagtcccaaatgca
cacaaagactgggtgtgtgccctgggcctggtgccaggccatccggttttgctgagtggc
tgcagaggcggcattctgaaactctggaatgtggacacttttgtgcccgttggagagatg
agaggtcatgacagtcccatcaatgccatttgtgttaactccacccatgtctttactgct
gctgatgatcgaaccgtgagaatctggaaggcccacaacttgcaagatggtcaactctct
gacaccggcgatctgggggaggatattgccagtaattaa

DBGET integrated database retrieval system