KEGG   Mus musculus (mouse): 16565
Entry
16565             CDS       T01002                                 

Gene name
Kif21b, 2610511N21Rik, mKIAA0449
Definition
(RefSeq) kinesin family member 21B
  KO
K24185  kinesin family member 21
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16565 (Kif21b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16565 (Kif21b)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    16565 (Kif21b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16565 (Kif21b)
SSDB
Motif
Pfam: Kinesin WD40 Microtub_bd DUF5082 DUF4094
Other DBs
NCBI-GeneID: 16565
NCBI-ProteinID: NP_001034561
MGI: 109234
Ensembl: ENSMUSG00000041642
Vega: OTTMUSG00000026867
UniProt: Q9QXL1 F8VQE2
Position
1 E4; 1 59.61 cM
AA seq 1624 aa
MAGQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
EQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDTVTSEEEQGIIPRAIAHL
FRGIDERKRRAQEKGVTGPEFKVSAQFLELYNEEILDLFDSTRDPDARHRRSNIKIHEDA
NGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCA
QPDLVNETVTGLPDGAAPTGTEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCG
LLALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLN
TLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGTEGYSD
LFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKAGDGNEAIGALIQ
NYIREIEELRTKLLESEAMNESLRRSLSRASARNPYSLGASPAGPAFGGSPATSMEDASE
VIRKAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLQAENSEETDENEAEEEEEERDESGC
EEEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQRR
LQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNR
DLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETK
RNREIAQLKKEQRRQEFQIRALESQKRQQEIVLRRKTQEVSALRRLAKPMSERVAGRVGL
KPPNMDSGAEVSASTTSSEAESGARSVSSIVRQWNRKIDHFLGDRPTATVNGGRPARKKF
QKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRR
KREHLQAESPEEEKGLQELAEEIEVLAANIDYINDSITDCQATIVQLEETKEELDSTDTS
VVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDMTGSSQNHLLLDA
LREKAEAHPELQALIYNVQHENGYASTDEEVSEFSEGSFSQSFTMKGSTSHDDFKFKGEP
KLSAQMKAVSAECLGPPLDSSTKNITKSLASLVEIKEDGVGFSIRDPYYRDKVSRTVSLP
TRGSTFPRQSRGATDTSPLTRRKSYDRGQPIRSTDMGFTPPSSPPTRPRNDRNVFSRLTS
NQSQGSALDKSDDSDSSLSEVLRGIITPIGGAKGARTAPLQCISMAEGHTKPILCLDATD
ELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSSSYIKVWDIRD
SAKCIRTLTSSGQVISGDACIATSTRAITSAQGEHQINQMALSPSGSMLYVASGNAVRIW
ELNRFQPIGKLTGHIGPVMCLTVTQTSNQHDLVVTGSKDHYVKMFQLGDCVTGTIGPTHN
FEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFVPGRP
MLLSACRAGFIKVWNVDNFTPIGEIKGHDSPINAICTNSKHIFTASSDLTVKFWSIRRLP
AAHP
NT seq 4875 nt   +upstreamnt  +downstreamnt
atggctggccagggcgactgctgcgtcaaagtggccgtcaggatccggccccagctgtca
aaggagaagattgaaggctgtcacatctgtacctccgttaccccgggagagccccaggtc
ctgctggggaaggacaaggccttcacctatgactttgtctttgacctggacacctggcag
gagcaaatctattcgacctgtgtgagcaaactcatcgaaggctgctttgagggctataat
gccacagtcctagcctatggacagacaggggctgggaagacatatactatgggcaccggc
tttgacacagtgacatcagaagaggagcagggcatcatcccaagggccattgcacatctc
ttcaggggcatcgacgaacgcaagcggcgggcacaagagaagggtgtgactgggcctgag
ttcaaagtcagtgctcaattcctggagctctacaatgaagagatccttgacctatttgac
agcacccgtgaccccgatgcccgacaccgcaggtccaacatcaagatccacgaggatgcc
aacggtggcatctacaccacaggtgtcacttctcgcctgatcaactcccaggaggagctg
atccagtgcctgaagcagggcgccctgtcacgtaccacagccagcacccagatgaatgta
cagagctcccgatcccatgccatcttcaccatccacctgtgccagatgcgcgtgtgtgcc
cagcctgacctggtgaatgagaccgtgactgggcttccagatggagccgcccccacaggc
actgagtacgagactctcactgctaagtttcacttcgtggacttggctggctcagagcgg
ctgaagcggacaggggccaccggcgaacgggccaaagagggcatctccatcaactgtggt
ctgctggccttgggcaatgtgatcagcgccttgggggaccagagcaagaaggtcgtgcac
gtgccttacagggactccaagctcactcggctgctccaggactctcttggaggcaacagc
cagaccatcatgatcgcctgtgtgagcccctcggatcgggacttcatggagacacttaac
actctcaaatatgccaaccgggcccgcaacatcaaaaacaaagtggtggtgaaccaggac
aagaccagccagcagatcagcgcgctgcgggctgagatcgcacgcctgcagatggagttg
atggagtacaaagcgggcaagcgagtgattggggaggacggtacagagggctacagtgac
ctgttccgagagaacgccatgctgcagaaggagaatggggcgctgcggctccgagtgaag
gccatgcaggaagccattgatgccatcaacaaccgggtcacacaactcatgagccaggag
gccaacctgcttctggccaaggctggtgatggcaatgaggccattggtgctctgatccag
aactacatccgggagatcgaggagctgcgaacaaagctcctggagagtgaggctatgaat
gagtccctccgcagaagcctctcccgggcttccgctcggaatccctactccctgggagca
tctccagcaggtccagcctttgggggcagccccgccacctccatggaagatgcttctgaa
gtgatccgcaaggctaagcaagacctggagcggctgaaaaagaaggaggtcaggcagcgg
aggaagagcccagagaaagaagcgttcaagaagagggcaaaactccaggcagaaaacagt
gaggagacagacgagaacgaggctgaggaggaggaggaagagcgagatgaaagtggctgt
gaggaggaggaaggtcgtgaggatgaggatgaagactcgggcagtgaagagagcctggta
gactcagactccgaccctgaagaaaaggaagtgaacttccaggccgacctggcagacctg
acgtgtgagatcgagatcaagcagaagctgatcgacgagctggagaacagccagcggcgg
ctgcagacgctcaagcaccagtacgaggagaagctaattctgctgcagaacaagatccgg
gatacgcagctggagcgtgaccgcgtgctgcagaacctcagcactatggagtgctacacg
gaagagaaggccaacaagataaaggcagattatgagaagagactgcgggagatgaaccgg
gacctgcagaagctacaggctgctcaaaaagaacatgccaggctactcaagaaccagtct
cgctatgaaagggagctgaagaagctacaagcggaggtagctgagatgaagaaggccaag
gtagccctcatgaagcaaatgcgtgaggagcagcagcggcggcgactggtggagaccaag
aggaaccgggagattgctcagctcaagaaggagcaacggaggcaggagtttcagatacga
gccctggaatctcagaagcgccagcaggaaatagttctgaggaggaaaacccaggaggtt
tctgcactgaggcgcctggcaaagcccatgtctgagcgagtggctgggcgtgtaggattg
aagccccccaatatggattctggggctgaggtgtctgccagcaccacctcgtctgaggct
gagtcgggagcccgctccgtctccagcatagtgcgtcagtggaaccggaagatcgaccac
ttcctgggagaccgccccaccgccactgtcaatggcggccgcccagccaggaaaaagttc
caaaagaagggagccagccaaagcttcagtaaggctgcgagactcaaatggcagtccctg
gaacggaggatcattgacattgtcatgcagagaatgaccatcgtcaacctggaggctgat
atggagcgtctcataaagaaaagggaggagctcttcctcctgcaggaggcgctgcggagg
aagcgggagcacctgcaggctgagagcccagaggaggagaaggggctccaggagctggct
gaggagatcgaagtgttggcagccaatattgactacatcaacgacagcatcactgactgc
caagccaccatcgtgcagctggaggaaaccaaggaggagctggactcaacagacacgtca
gtggtcattagctcctgctctctggctgaagcccgcctcctgctagacaacttcctcaag
gcgtccattgacaagggacttcaagtagcacagaaggaagcccagatccggctgctagaa
ggacgccttagacagacagacatgacaggctcttcccagaaccacctgctcctagacgct
ttgcgtgagaaggccgaggcacaccccgagctgcaggccctcatctacaatgtgcagcat
gagaatggctatgcaagcacagatgaggaagtttctgagttctctgaggggagcttttcc
cagtcatttaccatgaaaggctccaccagccacgatgacttcaagttcaagggtgagccc
aagctatccgcacagatgaaggccgtgtctgcggagtgcctaggacccccattggacagc
tctaccaagaacatcaccaagtccctggcctccctcgttgagatcaaagaggatggggtg
ggcttctctatccgggacccctactaccgggacaaggtctcacgcaccgtcagcctgccc
acccggggcagcactttccctcggcaatctcgaggtgccacggacacgtctcctcttacc
cgaaggaagtcttatgaccggggacagcccatcagatccacagacatgggattcacacct
ccctcatcacctcccactcggccccgcaacgaccgcaacgtcttctctcgtctcaccagc
aatcagagccagggctcagcactggacaagtctgatgacagcgactcctctttgtcggag
gtcctgaggggcatcatcacccccattggcggagctaagggagcgcggacggccccgctg
cagtgcatctccatggccgagggtcacaccaagcccatcctctgcctggatgccaccgat
gagctgcttttcacgggatccaaagaccgtagctgcaagatgtggaacctggtgacaggg
caggagattgcagctctcaagggtcaccccaacaacgtggtttctatcaaatactgcagc
cactcggggctggtgttctctgtgtccagctcctacatcaaggtgtgggatatccgggac
tcagccaagtgcattcggacactcacgtcctcaggccaggtgatctcaggagatgcgtgc
atagccacatccacccgcgccatcaccagtgcccagggggaacatcagatcaaccagatg
gccctcagcccctcaggctccatgctatacgttgcctctggcaatgctgtccgcatctgg
gagctcaacaggttccagcccattggcaaactgactggccacattggcccagtgatgtgc
ctaacagtcacccagacttcaaaccagcatgacctcgtggtgacgggctccaaggaccac
tatgtgaagatgttccagctgggcgactgtgtgacgggcaccattggcccaacccacaac
tttgagccccctcactatgatggtattgaatgcctggctatccaaggagacatactcttc
agtggctccagagacaatggcatcaagaagtgggacctggaccagcaggagctcatccag
caaatccccaacgctcacaaggactgggtgtgcgccctggcctttgtacccggccggccc
atgctgctgagcgcctgccgggccggcttcatcaaggtctggaatgtggacaacttcaca
cccattggtgagatcaagggccacgacagccccatcaatgccatctgcaccaacagcaag
cacatcttcacggcctccagtgacctgacagtgaagttctggagcatacggcggctacca
gcagcccacccttga

DBGET integrated database retrieval system