KEGG   Mus musculus (mouse): 16569Help
Entry
16569             CDS       T01002                                 

Gene name
Kif3b, AI854312, AW549267, mKIAA0359
Definition
(RefSeq) kinesin family member 3B
  KO
K20196  kinesin family member 3B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16569 (Kif3b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16569 (Kif3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Kinesin_assoc AAA_16
Motif
Other DBs
NCBI-GeneID: 16569
NCBI-ProteinID: NP_032470
MGI: 107688
Ensembl: ENSMUSG00000027475
Vega: OTTMUSG00000016751
UniProt: Q61771 Q3UHC4 Q6P1D3
Position
2 H1; 2 75.41 cM
AA seq 747 aa AA seqDB search
MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTSHEMPKTFTFD
AVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGVRGDPEKRGVIP
NSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLS
SFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGK
LNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRL
LQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQE
EIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEDGDDKDDYWREQQEK
LEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKN
IVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYTSLQQEVDIKTKK
LKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKNKIM
NRSFFDDEEDHWKLHPITRLENQQMMKRPVSAVGYKRPLSQHARMSMMIRPEPRYRAENI
MLLELDMPSRTTRDYEGPAISPKVQAALDAALQDEDEIQVDASSFESTASRKPKARPKSG
RKSGSSSSSSGNPASQFYPQSRGLVPK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttaaaaagctcagaatcagtccgggtggtggtccgctgtcggcccatgaat
ggcaaagaaaaggctgcatcttatgacaaggtggtagatgtggatgtgaagctggggcag
gtgtctgtgaagaaccccaaaggcacatcccatgagatgcccaagaccttcaccttcgac
gctgtgtatgattggaacgccaagcagtttgagctctatgatgagacgttccgaccactc
gtggactctgtgctgcagggtttcaatggcacaatttttgcctatggacaaacaggaact
gggaaaacctataccatggagggagttcgtggtgaccctgaaaaaagaggggtcatcccc
aactcctttgatcacatcttcacccacatctctcgatctcagaatcagcagtacctggtc
cgggcgtcttacttagagatctatcaagaagagattcgagacttgctttcaaaggatcag
accaaaaggctagagctcaaagagagaccagatacaggagtgtatgtaaaggatttgtct
tcttttgtcacgaagagtgtgaaggagatagagcatgtgatgaatgtgggaaaccagaac
cggtctgtcggtgctacaaacatgaatgagcacagctcacggtcgcatgcaatctttgtt
atcactattgaatgcagcgaggtgggcctggatggtgaaaaccacatccgggtaggaaag
ctgaatcttgtagatcttgctggcagtgagcggcaagccaagactggagctcaaggggaa
agactgaaggaagccaccaagatcaacctgtccctttccgccttgggtaatgttatctct
gcccttgtagatggcaaaagcacccatattccatatagagactcaaagctgaccaggctt
ctccaagattcccttggtggcaatgccaaaactgtgatggtagccaatgtggggcctgcc
tcttacaatgtagaagagaccctgaccactctgagatatgccaaccgtgccaaaaacatt
aagaacaagccaagggtcaatgaggacccaaaggatgctctgcttcgagaattccaagaa
gaaattgctcggctcaaggcccagctggaaaaacgttccattggcaggaggaagaggcga
gagaagcggagggaaggtggtggcagtggtgggggtggggaagaggaggaggaggaggga
gaagagggtgaggaggacggggatgataaggatgattactggcgggaacagcaagaaaaa
ctggagattgagaagcgggccattgtagaggaccacagcttggttgcagaggagaagatg
aggctgctgaaggagaaggagaaaaagatggaggacctgcggcgagagaaggatgctgca
gagatgctgggtgccaaaatcaaggccatggagagtaagctgcttgtcggaggaaaaaat
atagtagatcatacaaacgaacagcagaagatcctggagcaaaaacgccaggagatcgca
gagcagaaacgtcgagaaagagaaatccagcagcaaatggagagtcgagatgaggagacc
ctggaactgaaagagacttacacctcactgcagcaggaggtagacatcaagaccaaaaag
ctcaaaaagctcttttccaagcttcaggccgtgaaggccgagatccacgacctccaagaa
gaacacatcaaagagcgccaggagctggagcagacgcagaatgaactcacccgggagcta
aagctcaagcatcttattatagaaaactttattcccttggaagagaagaataaaattatg
aatagatccttttttgatgatgaagaagaccattggaaattacatcctataaccagactg
gaaaaccagcagatgatgaagcggcctgtctctgctgtgggatacaagagacctctgagc
cagcatgcacggatgtccatgatgattcggccagagccccggtacagggcggagaacatc
atgctcttggagttagatatgcccagccggacaaccagagactacgagggcccagccatc
tctcccaaggttcaggctgcgctggatgcagctctgcaggatgaagatgagatacaggtg
gatgcctcatcctttgaaagtactgccagcagaaaacccaaggccaggcccaagagtggc
aggaaatcaggatcctcctcttcctcctcaggaaaccctgcatctcagttttacccacag
tctcgggggctggttcccaagtaa

DBGET integrated database retrieval system