KEGG   Mus musculus (mouse): 16572
Entry
16572             CDS       T01002                                 

Symbol
Kif5a, D10Bwg0738e, Khc, Kif5, Kns, mKIAA4086
Name
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16572 (Kif5a)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16572 (Kif5a)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    16572 (Kif5a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16572 (Kif5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16572 (Kif5a)
   05012 Parkinson disease
    16572 (Kif5a)
   05014 Amyotrophic lateral sclerosis
    16572 (Kif5a)
   05016 Huntington disease
    16572 (Kif5a)
   05020 Prion disease
    16572 (Kif5a)
   05022 Pathways of neurodegeneration - multiple diseases
    16572 (Kif5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16572 (Kif5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16572 (Kif5a)
   04147 Exosome [BR:mmu04147]
    16572 (Kif5a)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16572 (Kif5a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16572 (Kif5a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16572 (Kif5a)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF3584 Spc7
Other DBs
NCBI-GeneID: 16572
NCBI-ProteinID: NP_001034089
MGI: 109564
Ensembl: ENSMUSG00000074657
UniProt: P33175 Q3US62
Position
10 D3; 10 74.5 cM
AA seq 1027 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQ
AAPSSTSDMYFASSGATSVAPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPL
HQETAAS
NT seq 3084 nt   +upstreamnt  +downstreamnt
atggcggagactaacaacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtctttgaccgcgtcttccccccaaacaccactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggttacaatggc
acaatcttcgcttatggacagacatcctcagggaaaacgcataccatggaggggaagctg
cacgaccctcagctgatgggcatcattccccggatcgctcgagacatcttcaaccacatc
tactccatggatgagaaccttgaattccacattaaggtatcttacttcgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacgaacctgtccgtgcatgaggacaaa
aaccgggtgccgtttgtcaagggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgatcgatgaggggaagtccaaccgtcacgtagctgtcaccaacatgaacgag
cacagttctcggagccacagcatcttcctcatcaacatcaagcaggagaacgtagagacc
gagcagaagctcagcgggaagctgtacctcgtggatctggccggaagcgagaaggtcagc
aagacaggggcagagggagccgttctggacgaggcaaagaatatcaacaagtcgctgtcg
gccctggggaacgtgatctctgcactggcagagggcaccaaaagctacgtgccgtaccgc
gacagcaaaatgacgaggattctccaggactctctgggagggaactgcaggactaccatg
ttcatctgctgctcgccgtccagctacaatgacgcagagaccaagtccacgctcatgttt
ggacagcgggcgaagaccatcaagaacactgcctcagtgaatctggagctgactgctgag
cagtggaagaagaagtatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctagaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctgggagctgagctctgcgaggagacccctgtgaat
gacaactcatccattgtggtacgcatcgcacctgaggaaaggcagaaatatgaggaagag
atccgccgtctctacaagcagcttgatgacaaggatgatgagatcaaccagcagagccag
ctcattgagaagctgaagcagcagatgctggaccaggaagagctgctcgtgtccactcgg
ggagacaacgagaaggtccagcgggagcttagccacctgcagtccgagaacgatgctgcg
aaggacgaggtgaaggaagtgctgcaggccctagaggagctggcggtcaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggacgagctgtcc
cagaaagtggccaccatgctgtccctggagtccgagctacagcggctccaggaggtcagt
ggacaccagcgaaagcggatcgctgaggtgctgaatgggctgatgagggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcccgtggagatcagtggggccatc
gaggaggagttcacggtggcccggctctacatcagcaagatcaagtcggaggtgaagtcc
gtggttaagcgatgtcggcagctggagaacctccaggtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcatcttgccaactgctcatctcacagcatgaggccaagatc
cgttcactcacggagtacatgcagactgtggagttgaagaaacggcacctggaagagtcc
tacgactccctgagcgatgagcttgccaggctccaggcgcacgaaactgtacacgaggta
gctctgaaagacaaggagccagacacacaggacgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcaccgtgaggcccatcaccggcagctggcccgcctccgggatgag
attaatgagaaacagaaaaccattgatgagctgaaagacctgaaccagaagctccagtta
gagctggagaagcttcaggccgactatgagaggctgaagaatgaagagaacgagaagagc
gccaagctccaggagctgacatttctgtatgagcgacatgagcagtccaagcaggacctc
aaggggctggaggagacagttgcccgtgaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcattcccaaaagcagaagatctcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttcgggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgctatgaaggacaagcgtagataccagcaggaggtggaccgcatc
aaagaagccgtgcggtacaagagctccggcaagcggggccattctgcccagatcgctaag
cctgtgaggcctggccactatcctgcctcctcacccaccaacccctacggcacccggagc
cccgagtgtatcagctacaccaacaacctcttccagaactaccagaacctgcacctgcag
gctgcgcctagctccacttcagatatgtactttgccagcagcggagccacatctgttgcc
cccttggcttcctaccagaaggccaacatggacaatggaaatgccacagatatcaacgac
aacaggagtgacctgccgtgtggctatgaggctgaggaccaggccaagcttttccctctc
caccaagagacagcagccagctaa

DBGET integrated database retrieval system