KEGG   Mus musculus (mouse): 16572Help
Entry
16572             CDS       T01002                                 

Gene name
Kif5a, D10Bwg0738e, Khc, Kif5, Kns, mKIAA4086
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16572 (Kif5a)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16572 (Kif5a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16572 (Kif5a)
   05016 Huntington disease
    16572 (Kif5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16572 (Kif5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16572 (Kif5a)
   04147 Exosome [BR:mmu04147]
    16572 (Kif5a)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16572 (Kif5a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16572 (Kif5a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16572 (Kif5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Spc7
Motif
Other DBs
NCBI-GeneID: 16572
NCBI-ProteinID: NP_001034089
MGI: 109564
Ensembl: ENSMUSG00000074657
UniProt: P33175 Q3US62
Position
10 D3; 10 74.5 cM
AA seq 1027 aa AA seqDB search
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQ
AAPSSTSDMYFASSGATSVAPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPL
HQETAAS
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggcggagactaacaacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtctttgaccgcgtcttccccccaaacaccactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggttacaatggc
acaatcttcgcttatggacagacatcctcagggaaaacgcataccatggaggggaagctg
cacgaccctcagctgatgggcatcattccccggatcgctcgagacatcttcaaccacatc
tactccatggatgagaaccttgaattccacattaaggtatcttacttcgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacgaacctgtccgtgcatgaggacaaa
aaccgggtgccgtttgtcaagggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgatcgatgaggggaagtccaaccgtcacgtagctgtcaccaacatgaacgag
cacagttctcggagccacagcatcttcctcatcaacatcaagcaggagaacgtagagacc
gagcagaagctcagcgggaagctgtacctcgtggatctggccggaagcgagaaggtcagc
aagacaggggcagagggagccgttctggacgaggcaaagaatatcaacaagtcgctgtcg
gccctggggaacgtgatctctgcactggcagagggcaccaaaagctacgtgccgtaccgc
gacagcaaaatgacgaggattctccaggactctctgggagggaactgcaggactaccatg
ttcatctgctgctcgccgtccagctacaatgacgcagagaccaagtccacgctcatgttt
ggacagcgggcgaagaccatcaagaacactgcctcagtgaatctggagctgactgctgag
cagtggaagaagaagtatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctagaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctgggagctgagctctgcgaggagacccctgtgaat
gacaactcatccattgtggtacgcatcgcacctgaggaaaggcagaaatatgaggaagag
atccgccgtctctacaagcagcttgatgacaaggatgatgagatcaaccagcagagccag
ctcattgagaagctgaagcagcagatgctggaccaggaagagctgctcgtgtccactcgg
ggagacaacgagaaggtccagcgggagcttagccacctgcagtccgagaacgatgctgcg
aaggacgaggtgaaggaagtgctgcaggccctagaggagctggcggtcaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggacgagctgtcc
cagaaagtggccaccatgctgtccctggagtccgagctacagcggctccaggaggtcagt
ggacaccagcgaaagcggatcgctgaggtgctgaatgggctgatgagggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcccgtggagatcagtggggccatc
gaggaggagttcacggtggcccggctctacatcagcaagatcaagtcggaggtgaagtcc
gtggttaagcgatgtcggcagctggagaacctccaggtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcatcttgccaactgctcatctcacagcatgaggccaagatc
cgttcactcacggagtacatgcagactgtggagttgaagaaacggcacctggaagagtcc
tacgactccctgagcgatgagcttgccaggctccaggcgcacgaaactgtacacgaggta
gctctgaaagacaaggagccagacacacaggacgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcaccgtgaggcccatcaccggcagctggcccgcctccgggatgag
attaatgagaaacagaaaaccattgatgagctgaaagacctgaaccagaagctccagtta
gagctggagaagcttcaggccgactatgagaggctgaagaatgaagagaacgagaagagc
gccaagctccaggagctgacatttctgtatgagcgacatgagcagtccaagcaggacctc
aaggggctggaggagacagttgcccgtgaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcattcccaaaagcagaagatctcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttcgggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgctatgaaggacaagcgtagataccagcaggaggtggaccgcatc
aaagaagccgtgcggtacaagagctccggcaagcggggccattctgcccagatcgctaag
cctgtgaggcctggccactatcctgcctcctcacccaccaacccctacggcacccggagc
cccgagtgtatcagctacaccaacaacctcttccagaactaccagaacctgcacctgcag
gctgcgcctagctccacttcagatatgtactttgccagcagcggagccacatctgttgcc
cccttggcttcctaccagaaggccaacatggacaatggaaatgccacagatatcaacgac
aacaggagtgacctgccgtgtggctatgaggctgaggaccaggccaagcttttccctctc
caccaagagacagcagccagctaa

KEGG   Mus musculus (mouse): 16573Help
Entry
16573             CDS       T01002                                 

Gene name
Kif5b, AL022807, Khc, Khcs, Kns1, Ukhc
Definition
(RefSeq) kinesin family member 5B
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16573 (Kif5b)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16573 (Kif5b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16573 (Kif5b)
   05016 Huntington disease
    16573 (Kif5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16573 (Kif5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16573 (Kif5b)
   04147 Exosome [BR:mmu04147]
    16573 (Kif5b)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16573 (Kif5b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16573 (Kif5b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16573 (Kif5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd DUF4226
Motif
Other DBs
NCBI-GeneID: 16573
NCBI-ProteinID: NP_032474
MGI: 1098268
Ensembl: ENSMUSG00000006740
Vega: OTTMUSG00000035843
UniProt: Q61768 Q9CUT6
Structure
PDB: 

Position
18 A1; 18 4.46 cM
AA seq 963 aa AA seqDB search
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTADKDIAITSDKPAAAVGMAGSFTDAERRK
CEEELAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKATDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGTVRGGGSFVQNNQPVGLRGGGG
KQS
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggcggagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgaa
tctgaagtgaaccgcggcgataagtacgtcgccaaattccagggagaagacacggtgatg
atcgcgtccaagccttatgcctttgatcgtgtgttccagtcaagcacatctcaagagcaa
gtatacaacgactgtgcaaaaaagattgttaaagatgttcttgagggctataatggaaca
atatttgcatatggacaaacatcatctgggaagacccacacgatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacttgttagatgtttcaaagactaacctttcagtccatgaagacaaaaac
cgtgttccctatgtaaaggggtgcacagaacgtttcgtgtgtagtccagatgaagtcatg
gataccatagatgaagggaaatccaacagacatgtcgcagttacaaatatgaatgaacat
agctctaggagtcacagcatatttcttattaatgtaaaacaagagaatacacaaacggaa
cagaaactcagtggaaagctttatctggttgatttagctggcagtgagaaggttagtaag
actggggctgaaggtgctgtgctggatgaagctaagaacatcaacaagtcactttctgca
cttggaaatgtcatttctgctttggcagagggcagtacctatgttccttatcgagatagt
aaaatgaccagaattcttcaagattcattaggtggcaactgtaggaccactattgtcata
tgctgctctccatcatcatacaatgagtctgagacaaagtcaacactcctctttggtcaa
agggccaaaacaattaagaacacagtctgtgtcaatgtagagttaactgcggagcagtgg
aaaaagaagtatgaaaaagaaaaggaaaaaaataaaactctacggaacactattcagtgg
ctggaaaacgagctaaaccgttggcgtaacggggagacagtgcctattgatgagcagttt
gacaaagagaaagctaatttggaagccttcacagcggataaagatattgctattaccagt
gataaaccagctgctgcagtcggaatggctggtagttttaccgatgctgaaagaagaaag
tgtgaagaagaacttgctaaattgtataaacaacttgatgacaaggatgaagagattaac
caacaaagccaattggtagagaaattgaagacacaaatgctggatcaggaagagcttctg
gcatcaaccagaagggatcaagataatatgcaagctgaactgaatcgcctccaagcagaa
aatgatgcttctaaagaagaagtcaaagaagttttacaggccttagaggaactggctgtt
aattatgatcagaagtctcaggaagttgaagacaaaacaaaggaatatgaattgcttagt
gatgaattgaatcaaaaatctgcaactttagcaagtattgatgctgagcttcagaagctg
aaggaaatgaccaaccaccagaagaaacgagcagctgaaatgatggcatcattattaaaa
gaccttgcagaaataggaattgctgtggggaataacgatgtgaagcaaccagaaggaact
ggtatgatagatgaagagtttactgttgcaagactctacattagcaaaatgaaatcagaa
gtaaagaccatggtgaaacgctgcaaacagctagaaagcacacagactgagagcaacaaa
aaaatggaagaaaatgagaaagagttagcagcatgccagcttcggatctcccaacatgaa
gccaaaatcaagtcactgactgagtaccttcagaatgtagaacaaaagaagaggcagctg
gaggagtctgttgattcccttggtgaggagctagtccaactccgagcacaagagaaagtc
catgaaatggaaaaagagcacttgaacaaggttcagactgcaaatgaagtcaagcaagct
gttgagcagcagatccagagtcacagagaaacccaccaaaaacaaatcagtagtttgcga
gatgaagtggaggcaaaggaaaagctaatcactgacctccaagaccaaaaccagaagatg
gtgttggagcaggaacggctaagggtggagcatgagaggctgaaggctacagaccaagag
aagagcaggaagctgcacgagctcacggttatgcaagacagacgagaacaagcaagacaa
gacttgaagggtttggaggagaccgtggcaaaagaacttcagactttacacaacctgcgt
aagctctttgttcaggacttggctaccagggtgaaaaagagcgccgaggtcgactctgac
gacactggcggcagtgctgcacagaagcagaaaatctccttccttgaaaacaaccttgaa
cagctcaccaaagtgcacaagcagttggtacgcgataatgcagatcttcgctgtgagctt
cctaagttagagaaacggcttagagctactgcagaaagagtgaaagctttggagtcagcc
ctgaaagaagccaaagaaaatgcatctcgagaccgtaaacgctatcagcaagaagtagac
cggataaaggaagcagtcaggtcaaagaacatggccagaaggggacattctgcccagatt
gcaaagccgatccgtcctggacagcatccagcggcctcgccaactcacccgggcacagtt
cgtggaggaggctcatttgttcagaacaaccagccagtggggcttcgtggtggtggaggc
aagcagtcgtaa

KEGG   Mus musculus (mouse): 16574Help
Entry
16574             CDS       T01002                                 

Gene name
Kif5c, KINN, Khc, NKHC, NKHC2
Definition
(RefSeq) kinesin family member 5C
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16574 (Kif5c)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16574 (Kif5c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16574 (Kif5c)
   05016 Huntington disease
    16574 (Kif5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16574 (Kif5c)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16574 (Kif5c)
   04147 Exosome [BR:mmu04147]
    16574 (Kif5c)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16574 (Kif5c)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16574 (Kif5c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16574 (Kif5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 16574
NCBI-ProteinID: NP_032475
MGI: 1098269
Ensembl: ENSMUSG00000026764
Vega: OTTMUSG00000012481
UniProt: P28738
Structure
PDB: 

Position
2 C1.1; 2 28.68 cM
AA seq 956 aa AA seqDB search
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVL
QHLEMELNRWRNGEAVPEDEQISAKDQKSLEPCDNTPIIDNITPVVDGISAEKEKYDEEI
TSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAK
DEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSN
HQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSL
VNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQ
DSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEVKKALEQQMESHREAHQKQLSRL
RDEIEEKQRIIDEIRDLNQKLQLEQERLSSDYNKLKIEDQEREVKLEKLLLLNDKREQAR
EDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENNL
EQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEV
DRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gcggagatcctccgcggggacaaattcatccccaaattcaaaggcgaggagacggtggtg
atcgggcaagggaagccgtatgtctttgaccgagtgctgccgcccaacacaacccaggag
caggtctacaatgcctgtgcaaagcagattgtcaaagatgtccttgagggttataatgga
acaatttttgcatatgggcagacttcatcaggaaaaactcataccatggaggggaagtta
catgatcctcagcttatgggtatcattccaaggattgcacatgatatttttgatcacatc
tattccatggacgagaacctggagtttcatatcaaggtttcctattttgagatctacttg
gacaaaataagggacttgcttgatgtgtccaagaccaacttggcagttcatgaagacaaa
aacagagtcccctatgtaaaggggtgcaccgagaggtttgtgtcaagcccggaggaggtc
atggatgtgatcgatgagggcaaagcaaaccgacacgtggctgtgacaaacatgaacgaa
cacagctctaggagtcacagtatcttcctgattaacattaagcaagagaatgtggagact
gaaaaaaaactcagcgggaagctgtatttggttgatttggctgggagtgaaaaggtcagc
aaaaccggtgccgagggagctgttcttgatgaagctaaaaatatcaacaagtctttgtct
gctcttggaaatgtgatttctgccttggcagaagggacaaaaacacatgtaccgtaccgg
gacagcaagatgactcggattctccaggactctctgggtgggaactgtaggaccaccatt
gtcatttgctgttctccttcagtcttcaatgaagccgagaccaagtccacgctgatgttt
ggacagagagcaaagaccatcaagaatacagtctctgtgaacttggaactaacagcagaa
gagtggaagaagaaatatgaaaaagagaaagagaagaacaaggccttgaagagtgtcctc
cagcatctggagatggagctgaacaggtggaggaacggggaagctgtacccgaggacgaa
cagatcagcgccaaggaccagaagagcctagagccctgtgacaacacacccatcatagac
aacatcacgcctgttgtggacggcatctctgccgagaaggagaagtatgacgaggagatc
accagtttgtaccgacagctcgatgataaggatgatgaaattaaccagcagagccagctg
gctgaaaagctgaagcaacagatgttggatcaggatgagctcctggcttccacgagaagg
gactatgagaagatccaggaggagctgacacgcctccagatcgaaaatgaggcagctaaa
gacgaagtgaaagaagtcctccaggccctggaggagctggctgtcaattacgaccagaag
tcacaagaagtggaggacaagaccagggccaacgagcaactgactgatgagctggcccag
aaaacgacgacactgacaaccacccagcgagagctgagtcagctgcaagagcttagtaac
caccagaaaaagagggccacagagatcctgaacctgcttctcaaggacctgggggagata
ggcggaattattggcaccaacgatgtgaagactctggcagatgtgaacggggtcattgag
gaggagttcaccatggcacgcctgtacattagcaagatgaagtcggaggtcaagtctctc
gtgaaccgcagcaagcagctggagagtgcccagatggactctaacaggaagatgaacgcc
agtgagcgcgagctggcagcgtgccagttgcttatctcacagcacgaagccaagatcaag
tctctgacagactacatgcagaacatggaacagaagaggcggcagctggaagagtcccag
gactccctcagcgaggaactggccaagctccgggcccaggaaaaaatgcacgaagtcagt
ttccaagataaggaaaaggagcacctgacgaggctgcaggatgctgaggaggtgaagaaa
gctctggagcagcagatggagagccaccgggaagcgcaccaaaagcagctgtccagactt
cgcgatgagattgaggagaagcagagaatcattgatgagatccgggatttgaatcagaaa
ctgcaactggaacaggagaggctcagctctgattataacaagctgaaaatagaggaccag
gagagagaagtgaaactggagaagctcctattgctcaatgacaaaagggagcaagccagg
gaggacctcaagggactggaggagactgtgtctagagaactccagacccttcataacctg
cgcaaactcttcgtccaggatttgacaacccgggtgaaaaagagtgtggagctggacagc
gacgatggagggggcagcgctgctcagaagcagaagatctccttcctggagaacaacctg
gaacagcttaccaaggtgcacaagcagctggtccgggacaatgcagatttgcgctgtgaa
ctccccaagctggagaagaggcttcgtgctaccgcagaacgcgtcaaggccttggagagt
gcgctgaaagaggccaaggagaatgccatgagggaccgaaaacgctaccagcaggaagta
gatcgcatcaaggaggctgtgcgagccaagaacatggccaggagggcacattcggctcag
atcgccaagcccatccgcccaggccattacccagcatcatctccgacagctgtccatgcc
gtccgaggaggaggaggtggctcttcaaactctactcactaccagaaataa

DBGET integrated database retrieval system