KEGG   Mus musculus (mouse): 16572
Entry
16572             CDS       T01002                                 

Gene name
Kif5a, D10Bwg0738e, K, Khc, Kif, Kif5, Kns, mKIAA4086
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16572 (Kif5a)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16572 (Kif5a)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    16572 (Kif5a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16572 (Kif5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16572 (Kif5a)
   05012 Parkinson disease
    16572 (Kif5a)
   05014 Amyotrophic lateral sclerosis
    16572 (Kif5a)
   05016 Huntington disease
    16572 (Kif5a)
   05020 Prion disease
    16572 (Kif5a)
   05022 Pathways of neurodegeneration - multiple diseases
    16572 (Kif5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16572 (Kif5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16572 (Kif5a)
   04147 Exosome [BR:mmu04147]
    16572 (Kif5a)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16572 (Kif5a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16572 (Kif5a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16572 (Kif5a)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF3584 Spc7
Other DBs
NCBI-GeneID: 16572
NCBI-ProteinID: NP_001034089
MGI: 109564
Ensembl: ENSMUSG00000074657
UniProt: P33175 Q3US62
Position
10 D3; 10 74.5 cM
AA seq 1027 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQ
AAPSSTSDMYFASSGATSVAPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPL
HQETAAS
NT seq 3084 nt   +upstreamnt  +downstreamnt
atggcggagactaacaacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtctttgaccgcgtcttccccccaaacaccactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggttacaatggc
acaatcttcgcttatggacagacatcctcagggaaaacgcataccatggaggggaagctg
cacgaccctcagctgatgggcatcattccccggatcgctcgagacatcttcaaccacatc
tactccatggatgagaaccttgaattccacattaaggtatcttacttcgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacgaacctgtccgtgcatgaggacaaa
aaccgggtgccgtttgtcaagggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgatcgatgaggggaagtccaaccgtcacgtagctgtcaccaacatgaacgag
cacagttctcggagccacagcatcttcctcatcaacatcaagcaggagaacgtagagacc
gagcagaagctcagcgggaagctgtacctcgtggatctggccggaagcgagaaggtcagc
aagacaggggcagagggagccgttctggacgaggcaaagaatatcaacaagtcgctgtcg
gccctggggaacgtgatctctgcactggcagagggcaccaaaagctacgtgccgtaccgc
gacagcaaaatgacgaggattctccaggactctctgggagggaactgcaggactaccatg
ttcatctgctgctcgccgtccagctacaatgacgcagagaccaagtccacgctcatgttt
ggacagcgggcgaagaccatcaagaacactgcctcagtgaatctggagctgactgctgag
cagtggaagaagaagtatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctagaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctgggagctgagctctgcgaggagacccctgtgaat
gacaactcatccattgtggtacgcatcgcacctgaggaaaggcagaaatatgaggaagag
atccgccgtctctacaagcagcttgatgacaaggatgatgagatcaaccagcagagccag
ctcattgagaagctgaagcagcagatgctggaccaggaagagctgctcgtgtccactcgg
ggagacaacgagaaggtccagcgggagcttagccacctgcagtccgagaacgatgctgcg
aaggacgaggtgaaggaagtgctgcaggccctagaggagctggcggtcaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggacgagctgtcc
cagaaagtggccaccatgctgtccctggagtccgagctacagcggctccaggaggtcagt
ggacaccagcgaaagcggatcgctgaggtgctgaatgggctgatgagggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcccgtggagatcagtggggccatc
gaggaggagttcacggtggcccggctctacatcagcaagatcaagtcggaggtgaagtcc
gtggttaagcgatgtcggcagctggagaacctccaggtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcatcttgccaactgctcatctcacagcatgaggccaagatc
cgttcactcacggagtacatgcagactgtggagttgaagaaacggcacctggaagagtcc
tacgactccctgagcgatgagcttgccaggctccaggcgcacgaaactgtacacgaggta
gctctgaaagacaaggagccagacacacaggacgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcaccgtgaggcccatcaccggcagctggcccgcctccgggatgag
attaatgagaaacagaaaaccattgatgagctgaaagacctgaaccagaagctccagtta
gagctggagaagcttcaggccgactatgagaggctgaagaatgaagagaacgagaagagc
gccaagctccaggagctgacatttctgtatgagcgacatgagcagtccaagcaggacctc
aaggggctggaggagacagttgcccgtgaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcattcccaaaagcagaagatctcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttcgggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgctatgaaggacaagcgtagataccagcaggaggtggaccgcatc
aaagaagccgtgcggtacaagagctccggcaagcggggccattctgcccagatcgctaag
cctgtgaggcctggccactatcctgcctcctcacccaccaacccctacggcacccggagc
cccgagtgtatcagctacaccaacaacctcttccagaactaccagaacctgcacctgcag
gctgcgcctagctccacttcagatatgtactttgccagcagcggagccacatctgttgcc
cccttggcttcctaccagaaggccaacatggacaatggaaatgccacagatatcaacgac
aacaggagtgacctgccgtgtggctatgaggctgaggaccaggccaagcttttccctctc
caccaagagacagcagccagctaa

KEGG   Mus musculus (mouse): 16573
Entry
16573             CDS       T01002                                 

Gene name
Kif5b, AL022807, Khc, Khcs, Kns1, Ukhc
Definition
(RefSeq) kinesin family member 5B
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16573 (Kif5b)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16573 (Kif5b)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    16573 (Kif5b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16573 (Kif5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16573 (Kif5b)
   05012 Parkinson disease
    16573 (Kif5b)
   05014 Amyotrophic lateral sclerosis
    16573 (Kif5b)
   05016 Huntington disease
    16573 (Kif5b)
   05020 Prion disease
    16573 (Kif5b)
   05022 Pathways of neurodegeneration - multiple diseases
    16573 (Kif5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16573 (Kif5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16573 (Kif5b)
   04147 Exosome [BR:mmu04147]
    16573 (Kif5b)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16573 (Kif5b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16573 (Kif5b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16573 (Kif5b)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 16573
NCBI-ProteinID: NP_032474
MGI: 1098268
Ensembl: ENSMUSG00000006740
Vega: OTTMUSG00000035843
UniProt: Q61768 Q9CUT6
Structure
PDB: 
6IGV 6IGN

Position
18 A1; 18 4.46 cM
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTADKDIAITSDKPAAAVGMAGSFTDAERRK
CEEELAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKATDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGTVRGGGSFVQNNQPVGLRGGGG
KQS
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggcggagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgaa
tctgaagtgaaccgcggcgataagtacgtcgccaaattccagggagaagacacggtgatg
atcgcgtccaagccttatgcctttgatcgtgtgttccagtcaagcacatctcaagagcaa
gtatacaacgactgtgcaaaaaagattgttaaagatgttcttgagggctataatggaaca
atatttgcatatggacaaacatcatctgggaagacccacacgatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacttgttagatgtttcaaagactaacctttcagtccatgaagacaaaaac
cgtgttccctatgtaaaggggtgcacagaacgtttcgtgtgtagtccagatgaagtcatg
gataccatagatgaagggaaatccaacagacatgtcgcagttacaaatatgaatgaacat
agctctaggagtcacagcatatttcttattaatgtaaaacaagagaatacacaaacggaa
cagaaactcagtggaaagctttatctggttgatttagctggcagtgagaaggttagtaag
actggggctgaaggtgctgtgctggatgaagctaagaacatcaacaagtcactttctgca
cttggaaatgtcatttctgctttggcagagggcagtacctatgttccttatcgagatagt
aaaatgaccagaattcttcaagattcattaggtggcaactgtaggaccactattgtcata
tgctgctctccatcatcatacaatgagtctgagacaaagtcaacactcctctttggtcaa
agggccaaaacaattaagaacacagtctgtgtcaatgtagagttaactgcggagcagtgg
aaaaagaagtatgaaaaagaaaaggaaaaaaataaaactctacggaacactattcagtgg
ctggaaaacgagctaaaccgttggcgtaacggggagacagtgcctattgatgagcagttt
gacaaagagaaagctaatttggaagccttcacagcggataaagatattgctattaccagt
gataaaccagctgctgcagtcggaatggctggtagttttaccgatgctgaaagaagaaag
tgtgaagaagaacttgctaaattgtataaacaacttgatgacaaggatgaagagattaac
caacaaagccaattggtagagaaattgaagacacaaatgctggatcaggaagagcttctg
gcatcaaccagaagggatcaagataatatgcaagctgaactgaatcgcctccaagcagaa
aatgatgcttctaaagaagaagtcaaagaagttttacaggccttagaggaactggctgtt
aattatgatcagaagtctcaggaagttgaagacaaaacaaaggaatatgaattgcttagt
gatgaattgaatcaaaaatctgcaactttagcaagtattgatgctgagcttcagaagctg
aaggaaatgaccaaccaccagaagaaacgagcagctgaaatgatggcatcattattaaaa
gaccttgcagaaataggaattgctgtggggaataacgatgtgaagcaaccagaaggaact
ggtatgatagatgaagagtttactgttgcaagactctacattagcaaaatgaaatcagaa
gtaaagaccatggtgaaacgctgcaaacagctagaaagcacacagactgagagcaacaaa
aaaatggaagaaaatgagaaagagttagcagcatgccagcttcggatctcccaacatgaa
gccaaaatcaagtcactgactgagtaccttcagaatgtagaacaaaagaagaggcagctg
gaggagtctgttgattcccttggtgaggagctagtccaactccgagcacaagagaaagtc
catgaaatggaaaaagagcacttgaacaaggttcagactgcaaatgaagtcaagcaagct
gttgagcagcagatccagagtcacagagaaacccaccaaaaacaaatcagtagtttgcga
gatgaagtggaggcaaaggaaaagctaatcactgacctccaagaccaaaaccagaagatg
gtgttggagcaggaacggctaagggtggagcatgagaggctgaaggctacagaccaagag
aagagcaggaagctgcacgagctcacggttatgcaagacagacgagaacaagcaagacaa
gacttgaagggtttggaggagaccgtggcaaaagaacttcagactttacacaacctgcgt
aagctctttgttcaggacttggctaccagggtgaaaaagagcgccgaggtcgactctgac
gacactggcggcagtgctgcacagaagcagaaaatctccttccttgaaaacaaccttgaa
cagctcaccaaagtgcacaagcagttggtacgcgataatgcagatcttcgctgtgagctt
cctaagttagagaaacggcttagagctactgcagaaagagtgaaagctttggagtcagcc
ctgaaagaagccaaagaaaatgcatctcgagaccgtaaacgctatcagcaagaagtagac
cggataaaggaagcagtcaggtcaaagaacatggccagaaggggacattctgcccagatt
gcaaagccgatccgtcctggacagcatccagcggcctcgccaactcacccgggcacagtt
cgtggaggaggctcatttgttcagaacaaccagccagtggggcttcgtggtggtggaggc
aagcagtcgtaa

KEGG   Mus musculus (mouse): 16574
Entry
16574             CDS       T01002                                 

Gene name
Kif5c, KINN, Khc, NKHC, NKHC2
Definition
(RefSeq) kinesin family member 5C
  KO
K10396  kinesin family member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16574 (Kif5c)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    16574 (Kif5c)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    16574 (Kif5c)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16574 (Kif5c)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16574 (Kif5c)
   05012 Parkinson disease
    16574 (Kif5c)
   05014 Amyotrophic lateral sclerosis
    16574 (Kif5c)
   05016 Huntington disease
    16574 (Kif5c)
   05020 Prion disease
    16574 (Kif5c)
   05022 Pathways of neurodegeneration - multiple diseases
    16574 (Kif5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16574 (Kif5c)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16574 (Kif5c)
   04147 Exosome [BR:mmu04147]
    16574 (Kif5c)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    16574 (Kif5c)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16574 (Kif5c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16574 (Kif5c)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 16574
NCBI-ProteinID: NP_032475
MGI: 1098269
Ensembl: ENSMUSG00000026764
Vega: OTTMUSG00000012481
UniProt: P28738
Structure
PDB: 
3X2T 3WRD 3J6H

Position
2 C1.1; 2 28.68 cM
AA seq 956 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVL
QHLEMELNRWRNGEAVPEDEQISAKDQKSLEPCDNTPIIDNITPVVDGISAEKEKYDEEI
TSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAK
DEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSN
HQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSL
VNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQ
DSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEVKKALEQQMESHREAHQKQLSRL
RDEIEEKQRIIDEIRDLNQKLQLEQERLSSDYNKLKIEDQEREVKLEKLLLLNDKREQAR
EDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENNL
EQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEV
DRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gcggagatcctccgcggggacaaattcatccccaaattcaaaggcgaggagacggtggtg
atcgggcaagggaagccgtatgtctttgaccgagtgctgccgcccaacacaacccaggag
caggtctacaatgcctgtgcaaagcagattgtcaaagatgtccttgagggttataatgga
acaatttttgcatatgggcagacttcatcaggaaaaactcataccatggaggggaagtta
catgatcctcagcttatgggtatcattccaaggattgcacatgatatttttgatcacatc
tattccatggacgagaacctggagtttcatatcaaggtttcctattttgagatctacttg
gacaaaataagggacttgcttgatgtgtccaagaccaacttggcagttcatgaagacaaa
aacagagtcccctatgtaaaggggtgcaccgagaggtttgtgtcaagcccggaggaggtc
atggatgtgatcgatgagggcaaagcaaaccgacacgtggctgtgacaaacatgaacgaa
cacagctctaggagtcacagtatcttcctgattaacattaagcaagagaatgtggagact
gaaaaaaaactcagcgggaagctgtatttggttgatttggctgggagtgaaaaggtcagc
aaaaccggtgccgagggagctgttcttgatgaagctaaaaatatcaacaagtctttgtct
gctcttggaaatgtgatttctgccttggcagaagggacaaaaacacatgtaccgtaccgg
gacagcaagatgactcggattctccaggactctctgggtgggaactgtaggaccaccatt
gtcatttgctgttctccttcagtcttcaatgaagccgagaccaagtccacgctgatgttt
ggacagagagcaaagaccatcaagaatacagtctctgtgaacttggaactaacagcagaa
gagtggaagaagaaatatgaaaaagagaaagagaagaacaaggccttgaagagtgtcctc
cagcatctggagatggagctgaacaggtggaggaacggggaagctgtacccgaggacgaa
cagatcagcgccaaggaccagaagagcctagagccctgtgacaacacacccatcatagac
aacatcacgcctgttgtggacggcatctctgccgagaaggagaagtatgacgaggagatc
accagtttgtaccgacagctcgatgataaggatgatgaaattaaccagcagagccagctg
gctgaaaagctgaagcaacagatgttggatcaggatgagctcctggcttccacgagaagg
gactatgagaagatccaggaggagctgacacgcctccagatcgaaaatgaggcagctaaa
gacgaagtgaaagaagtcctccaggccctggaggagctggctgtcaattacgaccagaag
tcacaagaagtggaggacaagaccagggccaacgagcaactgactgatgagctggcccag
aaaacgacgacactgacaaccacccagcgagagctgagtcagctgcaagagcttagtaac
caccagaaaaagagggccacagagatcctgaacctgcttctcaaggacctgggggagata
ggcggaattattggcaccaacgatgtgaagactctggcagatgtgaacggggtcattgag
gaggagttcaccatggcacgcctgtacattagcaagatgaagtcggaggtcaagtctctc
gtgaaccgcagcaagcagctggagagtgcccagatggactctaacaggaagatgaacgcc
agtgagcgcgagctggcagcgtgccagttgcttatctcacagcacgaagccaagatcaag
tctctgacagactacatgcagaacatggaacagaagaggcggcagctggaagagtcccag
gactccctcagcgaggaactggccaagctccgggcccaggaaaaaatgcacgaagtcagt
ttccaagataaggaaaaggagcacctgacgaggctgcaggatgctgaggaggtgaagaaa
gctctggagcagcagatggagagccaccgggaagcgcaccaaaagcagctgtccagactt
cgcgatgagattgaggagaagcagagaatcattgatgagatccgggatttgaatcagaaa
ctgcaactggaacaggagaggctcagctctgattataacaagctgaaaatagaggaccag
gagagagaagtgaaactggagaagctcctattgctcaatgacaaaagggagcaagccagg
gaggacctcaagggactggaggagactgtgtctagagaactccagacccttcataacctg
cgcaaactcttcgtccaggatttgacaacccgggtgaaaaagagtgtggagctggacagc
gacgatggagggggcagcgctgctcagaagcagaagatctccttcctggagaacaacctg
gaacagcttaccaaggtgcacaagcagctggtccgggacaatgcagatttgcgctgtgaa
ctccccaagctggagaagaggcttcgtgctaccgcagaacgcgtcaaggccttggagagt
gcgctgaaagaggccaaggagaatgccatgagggaccgaaaacgctaccagcaggaagta
gatcgcatcaaggaggctgtgcgagccaagaacatggccaggagggcacattcggctcag
atcgccaagcccatccgcccaggccattacccagcatcatctccgacagctgtccatgcc
gtccgaggaggaggaggtggctcttcaaactctactcactaccagaaataa

KEGG   Mus musculus (mouse): 16593
Entry
16593             CDS       T01002                                 

Gene name
Klc1, AI874768, Kn, Kns2
Definition
(RefSeq) kinesin light chain 1
  KO
K10407  kinesin light chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16593 (Klc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16593 (Klc1)
   05012 Parkinson disease
    16593 (Klc1)
   05014 Amyotrophic lateral sclerosis
    16593 (Klc1)
   05016 Huntington disease
    16593 (Klc1)
   05020 Prion disease
    16593 (Klc1)
   05022 Pathways of neurodegeneration - multiple diseases
    16593 (Klc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    16593 (Klc1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16593 (Klc1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     16593 (Klc1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16593 (Klc1)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_16 TPR_8 TPR_MalT TPR_19 TPR_17 ANAPC3 PPR RNPP_C JIP_LZII Uso1_p115_C GHL5 COG2 DUF4919
Other DBs
NCBI-GeneID: 16593
NCBI-ProteinID: NP_001020529
MGI: 107978
Ensembl: ENSMUSG00000021288
Vega: OTTMUSG00000027507
UniProt: Q7M702
Structure
PDB: 
6FV0

Position
12 F1; 12 61.13 cM
AA seq 551 aa
MYDNMSTMVYIKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLF
PNDEDEPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPESMEKRRSRESLNMDVVKYESGPDGGE
EMRKMKLGLVK
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgtatgacaacatgtccaccatggtgtacataaaggaagagaagctggagaagctcacg
caggatgagatcatctctaagaccaagcaagtgatccaggggctggaagccctgaagaat
gagcacaactccatcctgcagagtttgctggagacgctgaagtgcttgaagaaggatgac
gagagcaacctggtggaagagaaatccagcatgatccgcaagtccctggagatgctggag
cttggcctgagcgaggcgcaggtgatgatggcgctgtccaatcacctgaatgctgtggag
tccgagaagcaaaagctccgcgctcaggttcgacggctgtgccaggagaaccagtggctg
cgggatgagctggccaacacgcagcagaagttgcagaagagcgagcagtcggtggcgcag
ctggaggaggagaagaaacacctggagttcatgaaccagctgaagaagtacgacgacgac
atctccccctcggaggacaaagactctgattcttccaaagagccgttggatgatctcttc
ccaaatgacgaggacgaaccaggacaaggaatccagcagcagcacagtagtgctgcggcc
gccgcccagcagggcggctacgagatccctgcaaggctgcgcacgctccacaacttggtg
atccagtatgcttcacaggggcgttacgaggtggcggtgccactctgcaagcaggccctg
gaggatctggagaagacttccggccacgaccaccccgatgtggctaccatgctcaacatc
ttggccctggtgtacagggatcagaacaagtataaagatgcagctaacctcctgaacgac
gccctggctatccgcgagaaaaccctgggcagagatcaccccgcggtggcagcgactctg
aacaacctagcagtactgtacggtaagcgagggaagtacaaggaggcggagccgctgtgt
aaacgagccctggagatcagggagaaggttctgggaaaggatcatcctgatgttgccaaa
cagttaaataacctggccctgctgtgccagaaccagggcaagtacgaggaggtggagtat
tattaccagagggccctgggcatctaccagacgaagctggggcccgacgatcccaacgtg
gccaagaccaagaacaacctggcctcctgttatctgaaacaagggaagttcaagcaggca
gaaacgctgtacaaggagattctcacccgcgcacacgagcgggagtttggatctgtggac
gacgagaacaagcccatctggatgcacgctgaagagagagaggagtgcaaaggcaagcag
aaggacgggtcggcttttggagagtatggcggctggtataaagcctgcaaagtggacagt
cccaccgtcacaaccaccttgaaaaaccttggagcactttaccgacggcaggggaagttt
gaagctgcagagacattggaagaagccgccatgaggtcacgtaagcagggtcttgacaat
gttcacaaacagagagtggctgaagtgctaaatgaccctgagagcatggagaagcggagg
agccgggagagtctcaatatggacgtggtcaagtacgagagtggccctgacggaggggag
gaaatgagaaagatgaagctcgggctggttaaatga

KEGG   Mus musculus (mouse): 16594
Entry
16594             CDS       T01002                                 

Gene name
Klc2, 8030455F02Rik, AW212649, KLC_2, KLC-2
Definition
(RefSeq) kinesin light chain 2
  KO
K10407  kinesin light chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16594 (Klc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16594 (Klc2)
   05012 Parkinson disease
    16594 (Klc2)
   05014 Amyotrophic lateral sclerosis
    16594 (Klc2)
   05016 Huntington disease
    16594 (Klc2)
   05020 Prion disease
    16594 (Klc2)
   05022 Pathways of neurodegeneration - multiple diseases
    16594 (Klc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    16594 (Klc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16594 (Klc2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     16594 (Klc2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16594 (Klc2)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_MalT TPR_16 TPR_8 TPR_19 TPR_17 SNAP ANAPC3 PPR JIP_LZII Crescentin Coatomer_E TMF_TATA_bd DUF627 YabA TMF_DNA_bd Csm1_N KASH_CCD NUDE_C COG2 ATG16
Other DBs
NCBI-GeneID: 16594
NCBI-ProteinID: NP_001356289
MGI: 107953
Ensembl: ENSMUSG00000024862
Vega: OTTMUSG00000016355
Structure
PDB: 
3ZFW 6EJN 5OJF 6F9I 5FJY

Position
19 A; 19 4.25 cM
AA seq 619 aa
MATMVLPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLL
LRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKL
QRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDDLFPNEDEQSPAPSP
GGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVA
TMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKE
AEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGP
DDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREE
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRSRK
QGLDPASQTKVVELLKDGSGGRGHRRGSRDVAGPQSESDLEESGPAAEWSGDGSGSLRRS
GSFGKLRDALRRSSEMLVRKLQGGGPQEPPNSRMKRASSLNFLNKSVEEPVQPGGTGLSD
SRTLSSSSMDLSRRSSLVG
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggccacgatggtgcttcctcgagaggagaagctgagtcaggacgagatagtgctgggc
accaaggcggtgatccagggtttagagaccctgagaggggagcatcgtgccctgctagct
cccctagcttctcatgaagcaggcgaggccgagccgggctcacaggagcgctgcctcctc
ctgcgccgctccctggaggccatcgagctggggcttggggaggctcaggtgatcctggca
ttatcaagccatctgggggctgtggagtcagagaagcagaagctgcgggctcaggtgcgg
cgcctggtacaagagaaccagtggttgcgtgaggagctggcagggacacagcagaagctg
cagcgcagtgaacaggcggtggctcagctggaggaagagaagcagcacctgctattcatg
agtcagatccgaaagctggatgaggatgcttccccaaatgaggagaagggtgatgtcccc
aaagactccctggatgacctgtttcccaatgaagatgaacagagcccagcccccagccct
ggaggaggagatgtagctgcacagcatgggggctatgagatcccagcacggctacggacc
ctccacaacctggtaatccagtatgcttcacaaggccgctatgaggtggccgtgcccctc
tgcaagcaggcactggaagatttggagaagacatcaggccatgaccaccctgatgtggcc
accatgctgaacatcctggcactggtttatcgggaccagaataagtacaaggatgctgct
cacctgctcaatgatgccctggctatccgggaaaagacactgggcaaggaccacccagct
gtggctgcgaccctcaacaatctggctgttctctacggcaaacggggcaagtacaaagag
gctgagccactgtgcaagagagcactggagatccgggagaaggtcctgggcaagtttcac
ccagatgtggccaagcagctcagcaacctggccttgctgtgccagaaccagggcaaagct
gaggaggtggaatactactaccggagagccctggagatctatgccacacgccttggtcct
gatgaccccaatgtggcgaagaccaagaacaacctggcttcctgctacctgaaacagggc
aagtaccaggatgcagagaccctgtacaaggagatccttacccgtgcgcacgagaaggag
tttggctcagtcaatggagagaacaagcccatctggatgcacgcagaggagcgcgaggag
agcaaggataagcgccgggacagcgccccctatggggagtatggcagctggtacaaagcc
tgtaaagttgacagtcccacagtcaacaccactctgcgaagcttgggcgccctgtaccgg
cgccagggcaagctggaagccgcacacacactggaagactgtgccagccgcagccgcaaa
cagggcctggatcctgccagccagaccaaggtggtagaactgttaaaagatggcagtggt
ggacgaggacaccgccgtggcagcagagatgtggctgggcctcaatctgagtcggacctg
gaggagtcagggcctgcagctgagtggagtggggacggcagcggctctctgcggcgcagt
ggctcctttgggaagctccgggatgctctgagacgcagcagtgagatgctggtgaggaag
ctgcagggagggggcccacaggagccccctaactctaggatgaagagggccagctctctt
aacttccttaacaagagtgtggaagagccagtccagcctggaggcacgggtctttctgac
agccgcactttgagctccagctccatggacctctctcgaagaagctccctggtgggctaa

KEGG   Mus musculus (mouse): 232943
Entry
232943            CDS       T01002                                 

Gene name
Klc3, BC017147, Klct
Definition
(RefSeq) kinesin light chain 3
  KO
K10407  kinesin light chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    232943 (Klc3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    232943 (Klc3)
   05012 Parkinson disease
    232943 (Klc3)
   05014 Amyotrophic lateral sclerosis
    232943 (Klc3)
   05016 Huntington disease
    232943 (Klc3)
   05020 Prion disease
    232943 (Klc3)
   05022 Pathways of neurodegeneration - multiple diseases
    232943 (Klc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    232943 (Klc3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    232943 (Klc3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     232943 (Klc3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     232943 (Klc3)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_19 TPR_MalT TPR_17 TPR_16 ANAPC3 SNAP PPR Crescentin RNPP_C PPR_2 YabA Tox-GHH TMF_TATA_bd ERM
Other DBs
NCBI-GeneID: 232943
NCBI-ProteinID: NP_001272967
MGI: 1277971
Ensembl: ENSMUSG00000040714
Vega: OTTMUSG00000023189
UniProt: Q91W40
Position
7 A3; 7 9.62 cM
AA seq 508 aa
MSVQVAAPGSTGLGPERLNPEELVRQTRQVVQGLEALRAEHHSLAGHLAEALAGPGPVAG
VELLEEKQQVVNHSLEAIELGLGEAQVLLALSAHVSVLEAEKQRLRAQARRLAQENTWLR
EELEETQRRLRASEEAVAQLEEEKSHLQFLGQLRQYDPPEESQRPESPPRRDSLASLFPS
EEEEKKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERS
SGHCHPDVATMLNILALVYRDQNKYKEATELLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFQDVERHYARAL
SIYEALGGPQDPNVAKTKNNLASAYLKQNKYQQAEELYKEILSQEALPAPLGAPQGGTAG
DTQQQVLRRSSSFSKLRESIRRGSEKLVSRLRGEGMAGAAGMKRAMSLNMLNVDGPRAAR
TQLSQLSTRHLSEAPRTLSISTQDLSPR
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtctgtgcaggtggcagcccctggaagcacagggctgggcccagaacgcctgaacccc
gaggagctggtgcggcagacacgacaggttgtacagggactggaggccctgcgggccgag
caccatagtctggctgggcacctggcggaggccctggctggaccaggccctgtggctggt
gtggagctgctggaagagaagcaacaggtggtgaaccactcgctggaggccatcgagctg
gggctgggtgaggcccaggtgctgctggccctgtccgcacacgtgagtgtgttggaggct
gagaagcagaggctacgggcacaggcacggaggctagcccaagagaacacatggcttcga
gaggagctggaggagacacagaggcgactgcgggccagcgaggaggctgtggcccagctg
gaagaggagaagagccacctccagttcctggggcagctgaggcagtatgacccgcccgag
gagagccagaggcccgagtccccccctcgccgagacagcttggcatctctgttccccagt
gaagaggaggaaaagaaaggtcctgaggcagcaggagcagcagccgcgcagcagggtggc
tatgagatcccagctcgtctgcggaccctgcacaacctggtgatccagtatgctggccag
ggccgctatgaggtggcagttcccctatgtcgccaggctctggaggacctggagcggagc
tcgggccactgccatcctgacgtggccaccatgctcaacatcctggcactcgtgtacagg
gaccagaacaaatacaaggaagctacggagcttcttcacgacgccctgcagatccgggaa
cagacgctgggtcctgaacaccctgcagtggctgccaccctcaacaacctggctgtcctc
tatggaaaacgtggacgttaccgggaggcagaacccctctgccagcgtgctctggagatc
cgtgagaaggtcctgggtgcagaccaccctgatgtggccaagcagctcaacaacctggcc
ctactgtgccagaaccagggcaagtttcaggacgtggagcggcactatgcgcgggccctg
agcatctacgaggccctgggcgggccacaggacccaaatgtggccaagactaagaacaac
ctggcctcagcctacctgaaacagaacaagtatcagcaggcagaggagctatacaaggag
atcctcagccaggaggccctgcccgccccacttggagccccccagggaggcacagcaggc
gatacacagcagcaggtcctgcgcaggagcagttccttctctaagctccgggaatccatc
aggcgaggaagcgagaagctggtctcccgcctccgaggagagggcatggcaggggctgcc
gggatgaagagagccatgtcactcaatatgctgaacgtggatggtcccagggctgcccgg
acgcagctctcccagctctcaacccggcacctgagtgaggcccctcggaccctgagcatc
agcacacaagatctgagcccgcgctaa

KEGG   Mus musculus (mouse): 74764
Entry
74764             CDS       T01002                                 

Gene name
Klc4, 1200014P03Rik, AA408085, AW146303, Kn, Knsl8
Definition
(RefSeq) kinesin light chain 4
  KO
K10407  kinesin light chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    74764 (Klc4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    74764 (Klc4)
   05012 Parkinson disease
    74764 (Klc4)
   05014 Amyotrophic lateral sclerosis
    74764 (Klc4)
   05016 Huntington disease
    74764 (Klc4)
   05020 Prion disease
    74764 (Klc4)
   05022 Pathways of neurodegeneration - multiple diseases
    74764 (Klc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    74764 (Klc4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    74764 (Klc4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     74764 (Klc4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     74764 (Klc4)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_16 TPR_19 TPR_14 TPR_17 ANAPC3 PPR JIP_LZII RPN7 LUD_dom TMF_DNA_bd TMF_TATA_bd Csm1_N CENP-F_leu_zip COG2
Other DBs
NCBI-GeneID: 74764
NCBI-ProteinID: NP_083367
MGI: 1922014
Ensembl: ENSMUSG00000003546
UniProt: Q9DBS5
Position
17; 17 C
AA seq 619 aa
MSGLVLGQRDEPAGHRLSQEEILGSTKVVSQGLEALHSEHQAVLQSLSHTIECLQQGGHE
EGLVHEKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLR
DELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDEDGHGMEEKEGEATKDSLDDLFP
NEEEEDSGNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED
LERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNN
LAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYY
QRALAIYESQLGPDNPNVARTKNNLASCYLKQGKYSEAEALYKEILTCAHVQEFGSVDDD
HKPIWMHAEEREEMSRSRPRDSSAPYAEYGGWYKACRVSSPTVNTTLKNLGALYRRQGKL
EAAETLEECALRSRKQGTDPISQTKVAELLGEGDGRKAIQEGPGDSVKFEGGEDASVAVE
WSGDGSGTLQRSGSLGKIRDVLRRSSELLVRKLQGTEPRPSSSSMKRAASLNYLNQPNAA
PLQVSRGLSASTVDLSSSS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtcaggcttggtgttggggcagcgggatgagcctgcagggcaccggctcagtcaagag
gagatcttgggcagcaccaaggtggtgagccaagggctggaggccctacacagtgaacat
caggcagtgctgcagagcctgtcccacaccattgagtgtctgcaacagggaggccatgag
gaaggactggtccatgagaaggcccggcagctgcggcggtctatggagaacatcgagctg
gggctgagcgaggcccaggtgatgctggcgctggctagccacctgagcacagtggagtct
gagaagcagaagctgcgagcccaagtgcggcggctatgccaggagaatcagtggctccgg
gatgagctggcgggcactcagcagcgcctgcagcgcagcgagcaggctgtggctcagcta
gaggaagagaagaagcacctggagttcctgcggcagctgcggcagtatgatgaggacggc
cacggcatggaggagaaggagggagaggccaccaaagattctctggatgacctgttcccc
aatgaggaggaggaggactccggcaacgacttgtcccgtggtcagggtgctgcagcggcc
cagcagggtggatatgagatcccagcaaggttgcggaccctgcacaacctggtcatccag
tatgcagctcagggtcgctatgaggtggcggtgccactctgcaagcaagcgctagaggac
ctggagcgcacatctggccgaggtcaccctgatgtggctaccatgctcaacatcctggct
ctggtgtaccgggaccagaataagtacaaggaggctgctcatctgctgaacgatgctctc
agcatccgggagagcaccctgggccgggaccacccagccgtggctgccacactcaacaat
ctggctgtgctgtacggcaaacgcggtaaatacaaggaggcagagccactgtgccagcgg
gcactggagatccgagagaaggtcttgggcactgaccatccagatgtggcaaaacagctg
aacaacttggccctcctatgtcaaaaccagggcaagtacgaggcggtggaacgctattat
cagcgggcactagccatctatgagagccagctagggccagacaaccctaatgtagctcgg
accaagaataacctggcttcctgctacctaaagcagggcaagtactctgaggccgaggct
ctgtacaaagagatcctgacctgtgcccatgtgcaggagttcgggtctgtggatgatgac
cacaagccgatctggatgcatgctgaggaacgggaggagatgagcaggagccggccccgt
gacagcagtgcgccctatgcagagtacggagggtggtacaaggcctgcagagtgagcagc
cccacagtgaacactactctgaaaaacctaggggctctgtacaggcgccaggggaagctg
gaggcagccgagaccctggaggaatgtgctctgcgctcccggaaacagggtactgacccc
atcagtcagaccaaggtggcagagctgctcggggaaggagatggtagaaaggccatccag
gagggtcctggagacagcgtgaagttcgagggaggtgaagacgcatcagtggctgtggag
tggtcaggggatggcagtggcaccctccagaggagcggctctctgggcaagatccgggat
gtgcttcgtaggagcagtgagctactggtgaggaagctccaggggacggagccgcgacct
tccagcagcagcatgaagcgggcggcctcgctgaactacttaaaccaacccaatgcagcc
cccctccaggtctcccggggcctcagcgccagcactgtggacctttcttcaagtagctga

DBGET integrated database retrieval system