KEGG   Mus musculus (mouse): 16579Help
Entry
16579             CDS       T01002                                 

Gene name
Kifap3, KAP-3, KAP3, SMAP
Definition
(RefSeq) kinesin-associated protein 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: KAP Arm RICTOR_M Herpes_UL33 FPL
Motif
Other DBs
NCBI-GeneID: 16579
NCBI-ProteinID: NP_001292572
MGI: 107566
Ensembl: ENSMUSG00000026585
Vega: OTTMUSG00000018234
UniProt: P70188 Q9CRX5 Q3UZA5
Position
1; 1 H2.1
AA seq 793 aa AA seqDB search
MQGEDARYLKRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGERKECQKIIRLKS
LNANTDITSLARKVVEECKLIHPSKLSEVEQLLYYLQNRRDSLPGKEKKEKSSKPKDPPP
FEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALA
RVLREDWKQSVELATNIIYIFFCFSSFSHFHGLITHYKIGALCMNIIDHELKRHELWQEE
LSKKKKAVDEDLENQTLRKDYDKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMR
NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDL
LNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNENYKQIAMCVLYHISMDDRFKSMF
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKLKD
PLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISSDEEEEFVIECLGTLANLTIPDLDWEL
VLKEYKLVPFLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNA
QQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDII
AEYDEEWAKKIQSEKFRWHNSQWLEMVESRQLDESEQYLYGDDRIEPYIHEGDILERPDL
FYNSDGLITSEGAISPDFFNDFHLQNGDVVGQHAFPGSLGMDGFGQPLGILGRPATAYGF
RPDEPYYYSFGSR
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcgaggacgccagatacctcaaaaggaaagttaaaggggggaatattgatgta
catccatcagaaaaagctctcattgttcagtatgaagtggaagctaccattcttggagaa
atgggagatcccatgttgggagaacgaaaggaatgccaaaaaatcatccgtctgaagagt
ctcaatgctaacacagacatcacctctctggcccggaaggtggttgaggaatgtaagctc
atccatccctcaaagctaagcgaggtggagcagcttttgtactatctacagaaccgccga
gactcattgccgggaaaagaaaaaaaagaaaaatcaagcaagcctaaagacccacctcct
tttgaagggatggagattgacgaagtggccaacattaatgacatggacgaatacattgag
ctcttgtatgaagacattccagataaggttcggggttctgccttgatcctacagcttgct
cgaaatcctgataacctggaagagctattattaaatgaaactgccctgggtgcgctagca
agagtcctgagagaagactggaaacaaagtgttgagttagctacaaacatcatttatatc
ttcttttgcttttctagcttttctcattttcatggactcatcactcactacaaaattgga
gcactgtgtatgaatatcattgatcatgagttaaaaagacacgagctttggcaagaagaa
ctctctaagaagaagaaagctgttgatgaagaccttgaaaatcaaacattgagaaaggat
tatgacaaaacctttaaaaaataccaaggacttgtggtaaaacaagagcagctactgaga
gttgctctctacttgcttttgaatcttgcggaggacacacgtacagaactgaagatgagg
aacaagaatatcgttcacatgttggtgaaggctcttgatcgggacaattttgagctgctg
attctggtcgtgtcattcttaaagaaactgagtatttttatggagaataaaaatgacatg
gtagagatggatattgttgaaaaactggtaaaaatgataccctgtgagcatgaagatctc
ctgaatatcaccctccggctcctcttaaacctctcgtttgacacaggcctgaggaacaag
atggtacaagttgggcttctcccaaagctcactgcactcctgggcaatgaaaactacaaa
caaatagcaatgtgtgtgctttaccatataagcatggatgaccgctttaagtcaatgttt
gcatatactgactgcataccacagttaatgaagatgctctttgaatgttcagatgaacga
attgacttggagctgatttctttctgcattaatcttgctgctaacaagagaaatgtccag
ctcatctgtgaaggaaatgggctgaaaatgctcatgaaaagagctctgaagctcaaggac
ccactgctgatgaagatgatcagaaacatctcccagcatgatgggcccactaagaatttg
ttcattgattatgttggggaccttgcagcccagatttccagtgatgaagaggaggagttt
gtaatcgagtgtttgggaacgctggcaaatctgacaatcccagatctagactgggaactg
gtcctgaaggagtacaagctggttccattcctcaaagacaaactaaagccaggtgccgca
gaggatgaccttgttttagaagtggttatcatgattgggacggtgtctatggatgactct
tgtgctgccctactggccaaatctgggataatcccagccctcatcgagctgctgaacgct
caacaagaagatgatgaatttgtgtgtcaaataatctatgtcttctaccagatggtgttc
catcaggccacaagagatgtcataatcaaggaaacacaagctccagcatatctcattgac
ctgatgcatgataaaaataatgaaatccggaaagtctgtgataacacattagatatcatc
gcagagtatgatgaagagtgggccaagaaaattcagagtgagaagtttcgctggcataac
tctcagtggctggagatggtggagagccgtcagctggatgagagcgagcagtacttgtat
ggtgatgatcgcattgagccgtacatccatgaaggggacattcttgaaaggcctgacctt
ttctacaactcagacggactaattacctctgaaggagccataagtccagacttcttcaat
gattttcacctccagaatggagatgtggtggggcaacacgcatttcctggcagcctcggg
atggatggcttcgggcagccactggggatccttggacgtcctgccaccgcgtatggattc
cgccctgacgaaccttactactacagctttgggtctcgataa

DBGET integrated database retrieval system