KEGG   Mus musculus (house mouse): 16580
Entry
16580             CDS       T01002                                 
Symbol
Kifc5b, Hset, KNSL2, Kifc5a
Name
(RefSeq) kinesin family member C5B
  KO
K10405  kinesin family member C1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16580 (Kifc5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16580 (Kifc5b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    16580 (Kifc5b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16580 (Kifc5b)
SSDB
Motif
Pfam: Kinesin Microtub_bd CENP-F_leu_zip Crescentin ATG16 SYCE1 C2-set DUF2312 Filament HOOK Myosin_tail_1 EzrA GAS
Other DBs
NCBI-GeneID: 16580
NCBI-ProteinID: NP_444403
MGI: 2137414
Ensembl: ENSMUSG00000024301
UniProt: Q9QWT9 E9PUA5 Q9JKY9
Position
17:27136065..27151553
AA seq 672 aa
MDVQAQRKGREGKRNVELKAALVKSSSRLPLSASSLKRGPDQMEDALEPAKKRTRVMGAV
TKVDTSRPRGPLLSTVSQTQGHNAAQKGPKKTGPGGCSAVGTVLRSQKPAPAAPAKPGTS
TAPVVVGKRAGKRPAWDLKGQLCDLNEELKRYREKTETLELENRGLREQLREVQEQATTL
GTERNTLEGELASVRSRAEQDQQRLETLSARVLELEECLGTRERLLQELQGERLQLQEER
STLSTQLEEQERRFQATEAALSSSQEEVVCLRQKTEAQVTLLAEQGDRLYGLEMERRRLH
NQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDRPTGLSLSRSDDRRSTLT
GAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTME
GGPRGDPQLAGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQ
GGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSV
FQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLPLGPGERDRLRETQAINSSLSTLGL
VIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVN
QCVIGTAQANKK
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggacgtgcaggcgcagagaaagggaagggaagggaagaggaacgtagaactgaaggcg
gccctggtcaagtcctcctcccgactgcccctgtcagcaagcagcctcaagaggggtcct
gaccagatggaggatgccttggagcctgcaaagaaacggacacgagtcatgggtgcagtg
accaaagttgacacatcccgtcccagaggaccactcctcagcacagtgtcacagacccag
ggccacaatgcagctcagaaaggccctaagaagacaggacctggtgggtgctctgctgtt
ggtacagtgctgaggagccagaagccagctcccgctgctcctgcgaagcctggcacatcc
actgctcctgtggtggtagggaagagagctggcaaacgccctgcctgggacctgaagggc
cagttgtgtgacctcaatgaagagttgaaacgctatcgggagaagactgaaacgctggaa
ctggagaaccggggtcttcgggagcaactcagagaggtccaggagcaggccacgaccctg
gggacagagcggaacaccctggaaggggagctggccagtgtacgcagccgagctgagcag
gaccagcagaggctggagacgctgagtgcccgtgtcttggagctggaggaatgtctgggt
accagggaaaggctgcttcaggagcttcagggagagcggctgcaattgcaggaggagcgg
agcacactgagcacccaactggaggagcaggagaggaggtttcaggccacagaagcagct
ctgtcaagcagccaagaagaggtggtgtgtcttcggcagaagactgaagcccaggtgacc
ttactggctgagcaaggagaccggctctatgggttagagatggagcggcggcgactccac
aaccagctgcaggaactgaagggcaatatccgggtgttctgccgcgtgcgccctgtcctc
gaaggggaatccactccatctcctggcttcctcgtgtttcctcctggccctgctggaccc
tctgatcgcccgacgggccttagcctctcacgatctgatgatcggcgctccaccctgact
ggggccccggcacccactgtccgccatgatttctcctttgatcgggtgttcccgccggga
agcaagcaggaggaagtgtttgaggagatcgccatgcttgtccagtcagcactagatggc
taccctgtgtgcatttttgcctatggacagacaggcagtggcaagaccttcactatggaa
ggagggcctaggggagacccccaattggcagggctgatccctcgggccatgcggcatctg
ttctctgtggcccaggagatgagcggccagggctggacatacagttttgtggcgagttac
gtagagatctacaatgagaccgttcgagacctgctagctactgggccccgcaagggacaa
gggggcgagtgcgagatccgtcgggcaagcccagggagtgaggagcttactgtcaccaat
gcccgctatgtccctgtttcctgtgagaaagaggtggaggccctgctccatttggctcac
cagaaccgggctgtggcccacactgcccagaataagagatcatcacgcagtcatagtgtg
ttccagctgcagatttctggagagcatgcagcccggggcctgcagtgtggcgctcccctc
aaccttgtggacctagctgggagtgagcggctagaccctggcttacccctaggccctggg
gagcgtgatcgtcttcgggagacacaggccattaacagcagtctgtctacattgggactg
gtcataatggccctgagcaataaggagtcccacgtgccttaccgaaacagcaagctcacc
tacttgctgcagaactctctgggtggcagtgccaagatgcttatgtttgtgaatatttct
cctctggaagagaatgtctccgagtctctgaattcactacgctttgcttccaaggtgaac
cagtgtgtcattggtactgctcaggctaataagaagtga

DBGET integrated database retrieval system