KEGG   Mus musculus (mouse): 16588
Entry
16588             CDS       T01002                                 

Symbol
Kin, Kin17
Name
(RefSeq) Kin17 DNA and RNA binding protein
  KO
K13102  DNA/RNA-binding protein KIN17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    16588 (Kin)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   Other processing factors
    16588 (Kin)
SSDB
Motif
Pfam: Kin17_mid KN17_SH3 KOW RXLR zf-met zf-C2H2_jaz
Other DBs
NCBI-GeneID: 16588
NCBI-ProteinID: NP_079556
MGI: 96676
Ensembl: ENSMUSG00000037262
Vega: OTTMUSG00000011190
UniProt: Q8K339
Position
2:10085362..10097512
AA seq 391 aa
MGKSDFLSPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASEN
PQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTK
WLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVRRG
LEGKEQETPVFTELSRENEEEKVTFNLNKGAGGSAGATTSKSSSLGPSALKLLGSAASGK
RKESSQSSAQPAKKKKSALDEIMELEEEKKRTARTDAWLQPGIVVKIITKKLGEKYHKKK
GVVKEVIDRYTAVVKMTDSGDRLKLDQTHLETVIPAPGKRVLVLNGGYRGNEGTLESINE
KAFSATIVIETGPLKGRRVEGIQYEDISKLA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgggcaagtcggattttctgagccccaaggccatcgccaatagaattaagtccaaaggg
ctccagaagcttcgctggtactgccagatgtgccaaaagcaatgccgcgacgagaatggc
tttaagtgtcactgtatgtctgaatctcatcaaagacaactgttgctggcttcagaaaac
cctcagcagtttatggattatttttcagaggaattccgaaatgactttctggaacttctg
aggcgacgctttggcactaaaagggtccacaacaacattgtctacaatgaatacatcagc
caccgagagcacatccacatgaacgctacccagtgggagacactgaccgactttaccaag
tggctgggcagagagggcttgtgtaaagtggatgagacaccgaaaggctggtacattcag
tacatagacagagacccagaaaccatccgtcggcaactggaattagaaaaaaagaagaag
caagatctggacgatgaagaaaaaactgccaagttcattgaggagcaggtgagaagaggc
ctggaagggaaagagcaggagacacctgtttttacagaacttagccgagaaaatgaggaa
gaaaaagttacgttcaatctgaataaaggagcgggtggctcagcgggagctacaacatcc
aagtcaagctctttgggaccaagtgcactgaagctgctggggagcgcagcatccgggaaa
cggaaagagtcttcacagagctccgcccagcctgcgaagaagaagaagtcggccctggat
gagatcatggagctcgaagaggaaaagaaaaggaccgcacggacagacgcctggttacag
ccggggatcgttgtgaaaattataacgaagaagcttggggagaaatatcacaagaagaaa
ggggtcgttaaggaagtgattgacaggtacacagctgtggtaaagatgactgactctgga
gacaggctgaaactggaccagactcatttagagacagtcattccggccccggggaaaagg
gttctagttttaaatggaggctacagaggaaatgaaggcactctcgaatccatcaatgag
aaggctttttcagccacgatagtcattgaaactggacctttgaaaggacgcagagttgaa
ggtattcaatatgaagacatatctaaacttgcttga

DBGET integrated database retrieval system