KEGG   Mus musculus (mouse): 16589
Entry
16589             CDS       T01002                                 

Symbol
Uhmk1, 4732477C12Rik, 4930500M09Rik, AA673513, AI449218, AU021979, C820018A03Rik, KIS, Kist, P-CIP2
Name
(RefSeq) U2AF homology motif (UHM) kinase 1
  KO
K08877  serine/threonine-protein kinase Kist [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16589 (Uhmk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     16589 (Uhmk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  Other
   16589 (Uhmk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like RRM_1 Kdo APH RIO1 ABC1 TCAD9 Choline_kinase
Other DBs
NCBI-GeneID: 16589
NCBI-ProteinID: NP_034763
MGI: 1341908
Ensembl: ENSMUSG00000026667
Vega: OTTMUSG00000021543
UniProt: P97343
Position
1:complement(170020989..170043466)
AA seq 419 aa
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPG
TTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSE
LLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGL
SFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMK
LKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPGRRIPAEMALC
SPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEDEYEDVVEDVKEECQKYGPVVSL
LVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggggtccggctgcgcgtggggcgccgagccgccgcgcttcctggaggccttcggg
cggctgtggcaggtccagagccgcctgggcagcggctcgtcggcctcggtgtaccgggtg
cggtgctgcggtaccccgggctcgccccccggcgccctcaagcagttcctgcctccggga
accaccggggctgcggcctcggccgcggagtatggtttccgcaaagagagggcggcgctg
gagcagttgcagggtcacaggaacatcgtgactttatatggagtctttaccatacacttc
tctcccaatgtgccatcacgctgtctgctgcttgaactcctggatgtcagtgtttcggaa
ttgcttttatattccagtcatcagggctgctccatgtggatgatacagcactgtgcccga
gatgttctggaggccctcgcttttcttcaccatgagggctacgtccatgcagacctcaaa
ccacgaaacatcctgtggagtgcggagaatgagtgttttaagcttattgactttggactc
agcttcaaagaaggcaatcaggacgtaaagtatattcagacagacgggtatcgcgctcct
gaagcagagctgcagaactgcttggcccaggccggcctgcagagtgatacagaatgtacc
tcagctgttgatctgtggagcctcggaatcattttactggaaatgttctcaggaatgaag
ctgaaacatacagtcagatctcaggaatggaaggcaaacagttctgctattattgatcat
atatttgccagtaaagcagtggtgaatgccgcaattccagcctatcacctcagagacctt
atcaaaagcatgcttcatgatgacccgggcagaagaatccctgctgagatggcattgtgc
agcccattctttagcattccttttgcccctcatattgaagatctggtgatgcttccgact
ccagtgctcaggctcctcaatgtgctggatgatgattaccttgaaaatgaagatgaatat
gaagatgttgtagaagatgtgaaagaggagtgtcagaaatatggaccagtggtttctctg
cttgttccaaaggaaaatcctggcagaggacaagtcttcgttgagtacgcgaacgctggt
gattccaaagctgctcagaagttgctgactgggaggatgtttgacgggaagtttgttgtg
gctacattctacccgctgagtgcctacaagaggggatatctttatcaaaccttgctttaa

DBGET integrated database retrieval system