KEGG   Mus musculus (mouse): 16591Help
Entry
16591             CDS       T01002                                 

Gene name
Kl, alpha-kl
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu01100  Metabolic pathways
mmu04211  Longevity regulating pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04961  Endocrine and other factor-regulated calcium reabsorption
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    16591 (Kl)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    16591 (Kl)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    16591 (Kl)
  09149 Aging
   04211 Longevity regulating pathway
    16591 (Kl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    16591 (Kl)
   04147 Exosome [BR:mmu04147]
    16591 (Kl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     16591 (Kl)
Transporters [BR:mmu02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   16591 (Kl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   16591 (Kl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 16591
NCBI-ProteinID: NP_038851
MGI: 1101771
Ensembl: ENSMUSG00000058488
Vega: OTTMUSG00000055554
UniProt: O35082
Position
5; 5 G3
AA seq 1014 aa AA seqDB search
MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWARFARAPAPEAAGLLH
DTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPSDSPIVVAPSGAPSPPL
SSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLE
RLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYAELCFRHFGGQVKYWITID
NPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGRVSIAL
SSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPDFTESEKR
LIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQLLSWIDLEYNHPPIFIVENGWF
VSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFY
VDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPLEGTFPCDFAWGVVDNYVQVDTTL
SQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVDFSAIRPQITLLREMRVTHFRFSLD
WALILPLGNQTQVNHTVLHFYRCMISELVHANITPVVALWQPAAPHQGLPHALAKHGAWE
NPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYRAGHHLLRAHALAWHLYDDKF
RAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWL
NQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEMTDITW
LNSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIKNYVNEA
LKAYVLDDINLCGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSNGFLGSGT
LGRFCPEEYTVCTECGFFQTRKSLLVFISFLVFTFIISLALIFHYSKKGQRSYK
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgctagcccgcgcccctcctcgccgcccgccgcggctggtgctgctccgtttgctgttg
ctgcatctgctgctgctcgccctgcgcgcccgctgcctgagcgctgagccgggtcagggc
gcgcagacctgggctcgcttcgcgcgcgctcctgccccagaggccgctggcctcctccac
gacaccttccccgacggtttcctctgggcggtaggcagcgccgcctatcagaccgagggc
ggctggcgacagcacggcaaaggcgcgtccatctgggacactttcacccatcactctggg
gcggccccgtccgactccccgatcgtcgtggcgccgtcgggtgccccgtcgcctcccctg
tcctccactggagatgtggccagcgatagttacaacaacgtctaccgcgacacagagggg
ctgcgcgaactgggggtcacccactaccgcttctccatatcgtgggcgcgggtgctcccc
aatggcaccgcgggcactcccaaccgcgaggggctgcgctactaccggcggctgctggag
cggctgcgggagctgggcgtgcagccggtggttaccctgtaccattgggacctgccacag
cgcctgcaggacacctatggcggatgggccaatcgcgccctggccgaccatttcagggat
tatgccgagctctgcttccgccacttcggtggtcaggtcaagtactggatcaccattgac
aacccctacgtggtggcctggcacgggtatgccaccgggcgcctggccccgggcgtgagg
ggcagctccaggctcgggtacctggttgcccacaacctacttttggctcatgccaaagtc
tggcatctctacaacacctctttccgccccacacagggaggccgggtgtctatcgcctta
agctcccattggatcaatcctcgaagaatgactgactataatatcagagaatgccagaag
tctcttgactttgtgctaggctggtttgccaaacccatatttattgatggcgactaccca
gagagtatgaagaacaacctctcgtctcttctgcctgattttactgaatctgagaagagg
ctcatcagaggaactgctgacttttttgctctctccttcggaccaaccttgagctttcag
ctattggaccctaacatgaagttccgccaattggagtctcccaacctgaggcagcttctg
tcttggatagatctggaatataaccaccctccaatatttattgtggaaaatggctggttt
gtctcgggaaccaccaaaagggatgatgccaaatatatgtattatctcaagaagttcata
atggaaaccttaaaagcaatcagactggatggggtcgacgtcattgggtacaccgcgtgg
tcgctcatggacggtttcgagtggcataggggctacagcatccggcgaggactcttctac
gttgactttctgagtcaggacaaggagctgttgccaaagtcttcggccttgttctaccaa
aagctgatagaggacaatggctttcctcctttacctgaaaaccagccccttgaagggaca
tttccctgtgactttgcttggggagttgttgacaactacgttcaagtggacactactctc
tctcagtttactgacccgaatgtctatctgtgggatgtgcatcacagtaagaggcttatt
aaagtagacggggttgtagccaagaagagaaaaccttactgtgttgatttctctgccatc
cggcctcagataaccttacttcgagaaatgcgggtcacccactttcgcttctccctggac
tgggccctgatcttgcctctgggtaaccagacccaagtgaaccacacggttctgcacttc
taccgctgcatgatcagcgagctggtgcacgccaacatcactccagtggtggccctgtgg
cagccagcagccccgcaccaaggcctgccacatgcccttgcaaaacatggggcctgggag
aacccgcacactgctctggcgtttgcagactacgcaaacctgtgttttaaagagttgggt
cactgggtcaatctctggatcaccatgaacgagccaaacacacggaacatgacctatcgt
gccgggcaccacctcctgagagcccatgccttggcttggcatctgtacgatgacaagttt
agggcggctcagaaaggcaaaatatccatcgccttgcaggctgactggatagaaccggcc
tgccctttctctcaaaatgacaaagaagtggccgagagagttttggaatttgatataggc
tggctggcagagcctatttttggttccggagattatccacgtgtgatgagggactggctg
aaccaaaaaaacaattttcttttgccctatttcaccgaagatgaaaaaaagctagtccgg
ggttcctttgacttcctggcggtgagtcattacaccaccattctggtagactgggaaaag
gaggatccgatgaaatacaacgattacttggaggtacaggagatgactgacatcacatgg
ctcaactctcccagtcaggtggcagtggtgccttgggggctgcgcaaagtgctcaactgg
ctaaggttcaagtacggagacctcccgatgtatgtgacagccaatggaatcgatgatgac
ccccacgccgagcaagactcactgaggatctattatattaagaattatgtgaatgaggct
ctgaaagcctacgtgttggacgacatcaacctttgtggctactttgcgtattcacttagt
gatcgctcagctcccaagtctggcttttatcgatatgctgcgaatcagtttgagcccaaa
ccatctatgaaacattacaggaaaattattgacagcaatggcttcctgggttctggaaca
ctgggaaggttttgtccagaagaatacactgtgtgcaccgaatgtggattttttcaaacc
cggaagtctttgctggtcttcatctcgtttcttgtttttacttttattatttctcttgct
ctcatttttcactactccaagaaaggccagagaagttataagtaa

DBGET integrated database retrieval system