KEGG   Mus musculus (house mouse): 16593
Entry
16593             CDS       T01002                                 
Symbol
Klc1, AI874768, Kns2
Name
(RefSeq) kinesin light chain 1
  KO
K10407  kinesin light chain
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16593 (Klc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16593 (Klc1)
   05012 Parkinson disease
    16593 (Klc1)
   05014 Amyotrophic lateral sclerosis
    16593 (Klc1)
   05016 Huntington disease
    16593 (Klc1)
   05020 Prion disease
    16593 (Klc1)
   05022 Pathways of neurodegeneration - multiple diseases
    16593 (Klc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    16593 (Klc1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16593 (Klc1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     16593 (Klc1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16593 (Klc1)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_16 TPR_19 TPR_MalT TPR_17 ANAPC3 PPR RNPP_C JIP_LZII GlfT2_domain3 GHL5 COG2 DUF4919 SOGA
Other DBs
NCBI-GeneID: 16593
NCBI-ProteinID: NP_001020529
MGI: 107978
Ensembl: ENSMUSG00000021288
UniProt: Q7M702
Position
12:111724869..111774278
AA seq 551 aa
MYDNMSTMVYIKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLF
PNDEDEPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPESMEKRRSRESLNMDVVKYESGPDGGE
EMRKMKLGLVK
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgtatgacaacatgtccaccatggtgtacataaaggaagagaagctggagaagctcacg
caggatgagatcatctctaagaccaagcaagtgatccaggggctggaagccctgaagaat
gagcacaactccatcctgcagagtttgctggagacgctgaagtgcttgaagaaggatgac
gagagcaacctggtggaagagaaatccagcatgatccgcaagtccctggagatgctggag
cttggcctgagcgaggcgcaggtgatgatggcgctgtccaatcacctgaatgctgtggag
tccgagaagcaaaagctccgcgctcaggttcgacggctgtgccaggagaaccagtggctg
cgggatgagctggccaacacgcagcagaagttgcagaagagcgagcagtcggtggcgcag
ctggaggaggagaagaaacacctggagttcatgaaccagctgaagaagtacgacgacgac
atctccccctcggaggacaaagactctgattcttccaaagagccgttggatgatctcttc
ccaaatgacgaggacgaaccaggacaaggaatccagcagcagcacagtagtgctgcggcc
gccgcccagcagggcggctacgagatccctgcaaggctgcgcacgctccacaacttggtg
atccagtatgcttcacaggggcgttacgaggtggcggtgccactctgcaagcaggccctg
gaggatctggagaagacttccggccacgaccaccccgatgtggctaccatgctcaacatc
ttggccctggtgtacagggatcagaacaagtataaagatgcagctaacctcctgaacgac
gccctggctatccgcgagaaaaccctgggcagagatcaccccgcggtggcagcgactctg
aacaacctagcagtactgtacggtaagcgagggaagtacaaggaggcggagccgctgtgt
aaacgagccctggagatcagggagaaggttctgggaaaggatcatcctgatgttgccaaa
cagttaaataacctggccctgctgtgccagaaccagggcaagtacgaggaggtggagtat
tattaccagagggccctgggcatctaccagacgaagctggggcccgacgatcccaacgtg
gccaagaccaagaacaacctggcctcctgttatctgaaacaagggaagttcaagcaggca
gaaacgctgtacaaggagattctcacccgcgcacacgagcgggagtttggatctgtggac
gacgagaacaagcccatctggatgcacgctgaagagagagaggagtgcaaaggcaagcag
aaggacgggtcggcttttggagagtatggcggctggtataaagcctgcaaagtggacagt
cccaccgtcacaaccaccttgaaaaaccttggagcactttaccgacggcaggggaagttt
gaagctgcagagacattggaagaagccgccatgaggtcacgtaagcagggtcttgacaat
gttcacaaacagagagtggctgaagtgctaaatgaccctgagagcatggagaagcggagg
agccgggagagtctcaatatggacgtggtcaagtacgagagtggccctgacggaggggag
gaaatgagaaagatgaagctcgggctggttaaatga

DBGET integrated database retrieval system