KEGG   Mus musculus (house mouse): 16599
Entry
16599             CDS       T01002                                 
Symbol
Klf3, 9930027G08Rik, AL024007, Bklf, Tef-2
Name
(RefSeq) Kruppel-like factor 3 (basic)
  KO
K15605  krueppel-like factor 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    16599 (Klf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16599 (Klf3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    16599 (Klf3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-H2C2_5
Other DBs
NCBI-GeneID: 16599
NCBI-ProteinID: NP_032479
MGI: 1342773
Ensembl: ENSMUSG00000029178
UniProt: Q60980 Q545J5
Structure
Position
5:64960864..64990246
AA seq 344 aa
MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTPEGLTHGIQVE
PVDLTVNKRGSPPAAGGSPSSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPL
SMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNSGMP
VPVIESYEKPLLQKKIKIEPGIEPQRTDYYPEEMSPPLMNPVSPPQALLQENHPSVIVQP
GKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKF
ARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgctcatgtttgatccagtccctgtcaagcaggaggccatggaccctgtctcggtgtcc
ttcccgtcgaattacatagaatcgatgaagcccaacaaatatggggtcatttactccaca
ccgttgcctgataagttcttccagaccccagaaggcctcactcacgggatacaggtggag
ccggtggacctcacggtgaacaagcggggctccccgcctgctgcgggcggttctccttcc
tctctgaagttcccgtcccaccggagagcgtcacctggcctcagcatgccctcctccagt
ccgcccattaagaagtactcgcccccttctcctggcgtgcagccctttggagtacccctg
tctatgccgcctgtgatggcagccgcgctgtccagacacggaatccggagcccaggcatc
ctccccgtcattcagcccgtcgtggtccagcccgttccttttatgtataccagccacctg
cagcagcctctcatggtttccttgtcggaagagatggacaattcaaacagcggcatgcca
gtacctgtaattgaatcatatgagaagcccttattacagaaaaaaattaaaatagagcct
ggaattgaaccacagaggactgactattaccctgaagaaatgtcaccccctttaatgaac
ccagtgtcccccccgcaagccttgttgcaagagaaccatccttccgtcatcgtgcagcct
gggaagagacctctacctgtggaatccccggatacccaaaggaagcgcaggatacacaga
tgcgactatgatgggtgcaataaggtctacactaagagctcgcacttgaaagcacacaga
agaactcatacaggagaaaagccgtacaaatgcacctgggaaggctgcacgtggaagttc
gctcggtctgatgaactgacgagacatttccgaaaacacactgggatcaaacctttccag
tgtccagactgtgaccgaagcttctctcgctctgaccaccttgccctacacaggaaacgc
cacatgctagtctga

DBGET integrated database retrieval system