KEGG   Mus musculus (mouse): 16612
Entry
16612             CDS       T01002                                 

Symbol
Klk1, 0610007D04Rik, KAL-B, Kal, Klk1b6, Klk6, mGk-6
Name
(RefSeq) kallikrein 1
  KO
K01325  tissue kallikrein [EC:3.4.21.35]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    16612 (Klk1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    16612 (Klk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16612 (Klk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16612 (Klk1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     16612 (Klk1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   16612 (Klk1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   16612 (Klk1)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Imm17
Other DBs
NCBI-GeneID: 16612
NCBI-ProteinID: NP_034769
MGI: 102850
Ensembl: ENSMUSG00000063903
Vega: OTTMUSG00000058322
UniProt: P15947 A0A0B6VSQ6
Position
7:43874784..43879046
AA seq 261 aa
MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWV
LTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSND
LMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLP
NEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVP
GIYTRVLNFNTWIRETMAEND
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaggttcctgatcctgttcctagccctgtccctaggagggattgatgctgcacctcct
gtccagtctcgaattgttggaggatttaactgtgagaagaattcccagccctggcaagtg
gctgtgtaccgcttcaccaaatatcaatgtgggggtatcctgctgaacgccaactgggtt
ctcacagctgcccactgccataatgacaagtaccaggtgtggctgggcaaaaacaacttt
ttggaggatgaaccctctgcccaacaccggcttgtcagcaaagccatccctcaccctgac
ttcaacatgagcctcctgaatgagcacaccccacaacctgaggatgactacagcaatgac
ctgatgctgctccgcctcaaaaagcctgctgacatcacagatgttgtgaagcccatcgac
ctgcccactgaggagcccaagctggggagcacatgcctagcctcaggctggggcagcatt
acacccgtcaaatatgaatacccagatgagctccagtgtgtgaacctcaagctcctgcct
aatgaggactgtgccaaagcccacatagagaaggtgacagatgacatgttgtgtgcagga
gatatggatggaggcaaagacacttgtgcgggtgactcaggaggcccactgatctgtgat
ggtgttctccaaggtatcacatcatggggccctagcccttgcggtaaacccaatgtgccg
ggtatctacaccagagttttaaatttcaacacctggataagagaaactatggctgaaaat
gactga

DBGET integrated database retrieval system