KEGG   Mus musculus (mouse): 16615
Entry
16615             CDS       T01002                                 

Symbol
Klk1b16, Klk16, mGk-16
Name
(RefSeq) kallikrein 1-related peptidase b16
  KO
K01339  g-renin [EC:3.4.21.54]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16615 (Klk1b16)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.54  gamma-renin
     16615 (Klk1b16)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   16615 (Klk1b16)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2 DUF316
Other DBs
NCBI-GeneID: 16615
NCBI-ProteinID: NP_032480
MGI: 891982
Ensembl: ENSMUSG00000038968
Vega: OTTMUSG00000027255
UniProt: P04071 A0A1R3UCH4
Position
7:43771678..43791034
AA seq 261 aa
MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWV
LTAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSND
LMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKWQKPDDLQCMFTKLLP
NENCAKAYLLKVTDVMLCTIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGIPGVS
AIYTNLVKFNSWIKDTMMKNA
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtggttcctgatcctgttcctagccctgtccctaggagggattgatgctgcacctcct
gtccagtctcgaatagttggaggatttaaatgtgagaagaattcccaaccctggcaggtg
gctgtgtactaccacaaggaacacatttgcgggggagtcctgttggaccgcaactgggtt
ctcacagctgcccactgctatgtcgatgagtgtgaggtttggctgggcaaaaaccagtta
ttccaagaggaaccctctgctcaaaaccgattggtcagcaaaagcttccctcaccctggc
ttcaacatgaccctcctgacctttgaaaagttacctcctggggctgacttcagcaatgac
ctgatgctgctccgcctcagcaagcctgctgacatcacagatgttgtgaagcccatcgac
ctgcccacaaaggagcccaagctggatagcacatgtctagtgtcaggctggggcagcatt
acacccacaaaatggcaaaagccagatgatcttcagtgtatgttcaccaagctcctgccc
aatgagaactgtgccaaagcctacctactgaaagtcacagatgtcatgctgtgtacaata
gagatgggtgaagacaaaggcccttgtgtgggtgactcaggaggcccactgatttgtgat
ggtgttctccaaggaaccgtatcaattggccctgacccatgcggtatacctggtgtatca
gccatctacaccaaccttgttaagttcaactcctggataaaagatactatgatgaaaaat
gcttga

DBGET integrated database retrieval system