KEGG   Mus musculus (mouse): 16621Help
Entry
16621             CDS       T01002                                 

Gene name
Klkb1, APS, Kal-3, Kal3, Klk3, PSA
Definition
(RefSeq) kallikrein B, plasma 1
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    16621 (Klkb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    16621 (Klkb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     16621 (Klkb1)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   16621 (Klkb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 DUF1986 PAN_2
Motif
Other DBs
NCBI-GeneID: 16621
NCBI-ProteinID: NP_032481
MGI: 102849
Ensembl: ENSMUSG00000109764
Vega: OTTMUSG00000033163
UniProt: P26262 H9H9R5
Structure
PDB: 

Position
8 B1.1; 8 25.17 cM
AA seq 638 aa AA seqDB search
MILFNRVGYFVSLFATVSCGCMTQLYKNTFFRGGDLAAIYTPDAQYCQKMCTFHPRCLLF
SFLAVTPPKETNKRFGCFMKESITGTLPRIHRTGAISGHSLKQCGHQISACHRDIYKGLD
MRGSNFNISKTDNIEECQKLCTNNFHCQFFTYATSAFYRPEYRKKCLLKHSASGTPTSIK
SADNLVSGFSLKSCALSEIGCPMDIFQHSAFADLNVSQVITPDAFVCRTICTFHPNCLFF
TFYTNEWETESQRNVCFLKTSKSGRPSPPIPQENAISGYSLLTCRKTRPEPCHSKIYSGV
DFEGEELNVTFVQGADVCQETCTKTIRCQFFIYSLLPQDCKEEGCKCSLRLSTDGSPTRI
TYGMQGSSGYSLRLCKLVDSPDCTTKINARIVGGTNASLGEWPWQVSLQVKLVSQTHLCG
GSIIGRQWVLTAAHCFDGIPYPDVWRIYGGILSLSEITKETPSSRIKELIIHQEYKVSEG
NYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKEQGETQNILQKATI
PLVPNEECQKKYRDYVINKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGE
GCARKDQPGVYTKVSEYMDWILEKTQSSDVRALETSSA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgattttattcaaccgagtgggttattttgtttccttgtttgctaccgtctcctgtggg
tgtatgactcaactgtataaaaataccttcttcagaggtggggatctagctgccatctac
accccagatgcccagtactgtcagaagatgtgcacttttcaccccaggtgcctgctgttc
agctttctcgccgtgactccacccaaagagacaaataaacggtttggttgcttcatgaaa
gagagcattacagggactttgccaagaatacaccggacaggggccatttctggtcattct
ttaaagcagtgtggccatcaaataagtgcttgccaccgagacatatacaaaggacttgat
atgagagggtccaactttaatatctctaagaccgacaatattgaagaatgccagaaactg
tgcacaaataattttcactgccaatttttcacatatgctacaagtgcattttacagacca
gagtaccggaagaagtgcctgctgaagcacagtgcaagcggaacacccaccagcataaag
tcagcggacaacctggtgtctggattctcactgaagtcctgtgcgctttcggagataggt
tgccccatggatattttccagcactctgcctttgcagacctgaatgtaagccaggtcatc
acccccgatgcctttgtgtgtcgcaccatctgcaccttccatcccaactgccttttcttc
acgttctacacgaatgaatgggagacagaatcacagagaaatgtttgttttcttaagacg
tctaaaagtggaagaccaagtccccctattcctcaagaaaacgctatatctggatatagt
ctcctcacctgcagaaaaactcgccctgaaccctgccattccaaaatttactctggagtt
gactttgaaggggaagaactgaatgtgaccttcgtgcaaggagcagatgtctgccaagag
acttgtacaaagacaatccgctgccagttttttatttactccttactcccccaagactgc
aaggaggaggggtgtaaatgttccttaaggttatccacagatggctccccaactaggatc
acctatggcatgcaggggagctccggttattctctgagattgtgtaaacttgtggacagc
cctgactgtacaacaaaaataaatgcacgtattgtgggaggaacaaacgcttctttaggg
gagtggccatggcaggtcagcctgcaagtgaagctggtatctcagacccatttgtgtgga
gggtccatcattggtcgccaatgggtactgacagctgcccattgctttgatggaattccc
tatccagatgtgtggcgtatatatggcggaattcttagtctgtccgagattacgaaagaa
acgccttcctcgagaataaaggagcttattattcatcaggaatacaaagtctcagaaggc
aattatgatattgccttaataaagcttcagacgcccctgaattatactgaattccaaaaa
ccaatatgcctgccttccaaagctgacacaaatacaatttataccaactgttgggtgact
ggatggggctacacgaaggaacaaggtgaaacgcaaaatattctacaaaaggctactatt
cctttggtaccaaatgaagaatgccagaaaaaatacagagattatgttataaacaagcag
atgatctgtgctggctacaaagaaggcggaacagacgcttgtaagggagattccggtggc
cccttagtctgtaaacacagtggacggtggcagttggtgggtatcaccagctggggtgaa
ggctgcgcccgcaaggaccaaccaggagtctacaccaaagtttctgagtacatggactgg
atattggagaagacacagagcagtgatgtaagagctctggagacatcttcagcctga

DBGET integrated database retrieval system