KEGG   Mus musculus (house mouse): 16624
Entry
16624             CDS       T01002                                 
Symbol
Klk1b8, Klk8, Nrpn, TADG14, kallikrein, mGK-8
Name
(RefSeq) kallikrein 1-related peptidase b8
  KO
K01325  tissue kallikrein [EC:3.4.21.35]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    16624 (Klk1b8)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    16624 (Klk1b8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16624 (Klk1b8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16624 (Klk1b8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.35  tissue kallikrein
     16624 (Klk1b8)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   16624 (Klk1b8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   16624 (Klk1b8)
SSDB
Motif
Pfam: Trypsin DUF1986 DUF316 Trypsin_2
Other DBs
NCBI-GeneID: 16624
NCBI-ProteinID: NP_032483
MGI: 892018
Ensembl: ENSMUSG00000063089
UniProt: P07628
Position
7:43600090..43604368
AA seq 261 aa
MRFLILFLALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWV
LTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEIPPGADFSND
LMLLRLSKPADITDAVKPITLPTKESKLGSTCLASGWGSITPTKWQKPDDLQCVFLKLLP
IKNCIENHNVKVTDVMLCAGEMSGGKNICKGDSGGPLICDSVLQGITSTGPIPCGKPGVP
AMYTNLIKFNSWIKDTMTKNS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaggttcctgatcctgttcctagccctgtccctaggagggattgatgctgcacctcct
ctccagtctcgggtggttggaggatttaactgtgagaagaattcccaaccctggcaggtg
gctgtgtatgacaacaaggaacacatttgtgggggagtcctgttggaacgcaactgggtt
ctcacagctgcccactgctatgtcgaccagtatgaggtttggctgggcaaaaacaagtta
ttccaagaggaaccctctgctcaacaccgattggtcagcaaaagcttccctcaccctggc
ttcaacatgagcctcctgacactcaaagagatacctcctggggctgacttcagcaatgac
ctgatgctgctccgcctcagcaagcctgctgacatcacagatgctgtgaagcccatcacc
ctgcccacgaaggagtcaaaactggggagcacatgcctagcctcaggctggggcagcatt
acacccacgaaatggcaaaagccagatgatctccagtgtgtgttcctcaagctcctgcct
attaagaactgtatagaaaaccacaatgtgaaggtgacagatgtcatgctgtgtgcagga
gagatgagtggaggcaaaaacatttgcaagggtgactccggaggcccattgatctgtgat
agtgttctccaaggtatcacatcaacaggccctataccatgcggtaaacctggtgtacca
gccatgtacaccaaccttattaagttcaactcctggataaaagatactatgacgaaaaat
tcctga

DBGET integrated database retrieval system