KEGG   Mus musculus (mouse): 16627
Entry
16627             CDS       T01002                                 

Gene name
Klra1, A1, CH29-493D4.3, Klra22, Ly4, Ly49a, Ly49o<12, Ly49o<129>, Ly49v
Definition
(RefSeq) killer cell lectin-like receptor, subfamily A, member 1
  KO
K24207  killer cell lectin-like receptor subfamily A member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16627 (Klra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16627 (Klra1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16627 (Klra1)
SSDB
Motif
Pfam: Ly49 Lectin_C Ureide_permease Cadherin_C_2 PriX Silic_transp DUF3139
Other DBs
NCBI-GeneID: 16627
NCBI-ProteinID: NP_057868
MGI: 101907
Ensembl: ENSMUSG00000079853
Vega: OTTMUSG00000022866
UniProt: Q8MHR8
Structure
PDB: 
1QO3

Position
6 F3; 6 63.44 cM
AA seq 262 aa
MSEQEVTYSMVRFHKSAGLQKQVRPEETKGPREAGYRRCSFHWKFIVIALGIFCFLLLVA
VSVLAIKIFQYDQQKKLQEFLNHHNNCSNMQSDINLKDEMLKNKSIECDLLESLNRDQNR
LYNKTKTVLDSLQHTGRGDKVYWFCYGMKCYYFVMDRKTWSGCKQTCQSSSLSLLKIDDE
DELKFLQLVVPSDSCWVGLSYDNKKKDWAWIDNRPSKLALNTRKYNIRDGGCMLLSKTRL
DNGNCDQVFICICGKRLDKFPH
NT seq 789 nt   +upstreamnt  +downstreamnt
atgagtgagcaggaggtcacttattcaatggtgagatttcataaatctgcaggattgcag
aaacaagtgagacctgaggagactaaagggcccagagaagctggctacagaaggtgttca
ttccactggaagttcattgtgatagctcttggcatcttctgtttccttcttctggtagct
gtttcagtgttggcaataaaaatttttcagtatgatcaacaaaaaaaactgcaggaattt
ctaaaccaccacaataactgcagcaacatgcaaagtgacatcaacttgaaggatgaaatg
ctgaaaaataagtctatagagtgtgatcttctggaatccctcaacagggatcagaacaga
ttgtataataaaaccaagactgttttagattccttacagcacacaggcagaggtgataaa
gtatactggttctgctatggtatgaaatgttattatttcgtcatggacagaaaaacatgg
agtggatgtaaacagacctgccagagttccagtttatcccttctgaagatagatgatgag
gatgaactgaagttccttcagctcgtggttccttcagacagttgctgggttggattgtca
tatgataataagaaaaaagattgggcatggattgacaatcgcccatctaaacttgccttg
aacacaaggaaatacaatataagagatgggggatgtatgttgttatctaaaacaagacta
gacaatggtaactgtgatcaagtattcatctgtatttgtgggaagagactggataaattc
cctcattga

DBGET integrated database retrieval system