KEGG   Mus musculus (mouse): 16634Help
Entry
16634             CDS       T01002                                 

Gene name
Klra3, 5E6, Ly49c, NK-2.1, Nk-2, Nk2, Nk2.1
Definition
(RefSeq) killer cell lectin-like receptor, subfamily A, member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16634 (Klra3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    16634 (Klra3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ly49 Lectin_C MFS_Mycoplasma Cadherin_C_2 MAP17 AsmA
Motif
Other DBs
NCBI-GeneID: 16634
NCBI-ProteinID: NP_001276533
MGI: 101905
Ensembl: ENSMUSG00000067591
Vega: OTTMUSG00000022864
UniProt: Q64329
Structure
PDB: 

Position
6 F3; 6 63.44 cM
AA seq 266 aa AA seqDB search
MSEPEVTYSTVRLHKSSGLQKLVRHEETQGPREVGNRKCSAPWQLIVKALGILCFLLLVT
VAVLAVKIFQYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIK
REQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILK
IEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLS
KARIEDIDCNIPYYCICGKKLDKFPD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagccagaggtcacttactcaactgtgagacttcataagtcttcagggttgcag
aaactagtaaggcatgaggagactcaagggcccagagaagttggcaacagaaagtgttca
gcaccctggcaactcattgtgaaagctcttggaatcctctgtttccttcttcttgtaaca
gttgcagtgttggcagtaaagatttttcagtataatcaacacaaacaagaaatcaatgaa
actctaaaccaccaccataactgcagcaacatgcaaagggctttcaacttaaaggaagaa
atgttgacaaataagtctatagattgtaggccaagcaatgaaactctggaatatatcaaa
agagaacaggacagatgggacagtaaaacaaagactgttttagattcctcacgggacaca
ggcagaggtgttaaatactggttctgctatagtactaaatgttattatttcatcatgaac
aaaacgacatggagtggatgtaaagcgaactgccagcattatagcgttcccattctgaag
atagaagatgaagatgaactgaaattccttcaacgccatgttattccagagaattactgg
attggattgtcttatgataagaaaaaaaaggaatgggcatggattgacaatggcccatct
aaacttgacatgaaaataaggaaaatgaactttaagtctagaggatgtgtatttttatct
aaagcaagaatagaagatattgactgtaatattccctactactgtatttgtgggaagaaa
ctggataaattccctgattaa

DBGET integrated database retrieval system