KEGG   Mus musculus (mouse): 16638
Entry
16638             CDS       T01002                                 

Gene name
Klra7, LGL, LGL-1, Ly-49G., Ly-49G.1, Ly-49G.2, Ly-49G.3, Ly49, Ly49G.4, Ly49g, Ly49g1, Ly49g2
Definition
(RefSeq) killer cell lectin-like receptor, subfamily A, member 7
  KO
K24238  killer cell lectin-like receptor subfamily A member 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16638 (Klra7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16638 (Klra7)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16638 (Klra7)
SSDB
Motif
Pfam: Ly49 Lectin_C MAP17 Sema4F_C p25-alpha Baculo_11_kDa
Other DBs
NCBI-GeneID: 16638
NCBI-ProteinID: NP_001103793
MGI: 101901
Ensembl: ENSMUSG00000067599
Vega: OTTMUSG00000022875
UniProt: Q60654 F8WJ94
Position
6 F3; 6 63.44 cM
AA seq 280 aa
MSEQEVTYSTVRFHESSRLQKLVRTEEPQRPREACYREYSVPWKLIVIACGILCFLLLVT
VALLAITIFQHSQQKHELQETLNCHDNCSPTQSDVNLKDELLRNKSIECRPGNDLLESLS
RDQNRWYSETKTFSDSSQHTGVHKRPISKAEGKGRGFEKYWFCYGIKCYYFNMDRKTWSG
CKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGLSYDNKKKDWVWIDNGPSKLALNT
TKYNIRDGLCMSLSKTRLDNGDCDKSYICICGKRLDKFPH
NT seq 843 nt   +upstreamnt  +downstreamnt
atgagtgagcaggaggtcacttactcaactgtgagatttcatgagtcttcaaggttgcag
aaactagtgaggactgaggagcctcaaaggcccagagaagcttgctacagagagtattca
gtcccctggaagctcattgtgatagcttgtggaatcctctgtttccttctcctggtaact
gttgcattgttggcaataacgatttttcagcatagtcaacaaaaacatgaactacaggaa
actctaaattgccacgataactgcagccccacgcaaagtgacgtcaacttgaaggatgaa
ctgctgagaaataagtctatagagtgtaggccaggcaatgatcttctggaatccctcagc
agggatcagaacagatggtacagtgaaaccaagactttttcagattcctcacagcacaca
ggtgttcacaaaagacccatctccaaggcagaggggaagggtagaggttttgaaaaatat
tggttctgttatggtataaaatgttattatttcaacatggacagaaaaacgtggagtgga
tgtaaacagacctgccagatttccagcttatcccttctgaagatagacaatgaggatgaa
ctgaagttccttcagaacctggctccttcagacatttcctggattggattgtcatatgac
aataagaaaaaagattgggtatggattgacaatggcccatctaaacttgccttgaacaca
acgaaatataatataagagatggattatgtatgtcgttatctaaaacaagactagacaat
ggggactgtgataaatcatacatctgtatttgtggtaagagactggataaatttcctcat
tga

DBGET integrated database retrieval system