KEGG   Mus musculus (mouse): 16639
Entry
16639             CDS       T01002                                 

Gene name
Klra8, Cmv-1, Cmv1, Ly49h, Ly49u<129>
Definition
(RefSeq) killer cell lectin-like receptor, subfamily A, member 8
  KO
K24239  killer cell lectin-like receptor subfamily A member 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16639 (Klra8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    16639 (Klra8)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16639 (Klra8)
SSDB
Motif
Pfam: Ly49 Lectin_C MFS_Mycoplasma
Other DBs
NCBI-GeneID: 16639
NCBI-ProteinID: NP_001095090
MGI: 102968
Ensembl: ENSMUSG00000089727
Vega: OTTMUSG00000026958
UniProt: Q60682
Structure
PDB: 
4JO8

Position
6 F3; 6 63.44 cM
AA seq 266 aa
MSEQEVTFPTMRFHKSSGLNSQVRLEGTQRSRKAGLRVCSVPWQLIVIALGILCSLRLVI
VAVFVTKFFQYSQHKQEINETLNHRHNCSNMQRDFNLKEEMLTNKSIDCRPSYELLEYIK
REQERWDSETKSVSDSSRDTGRGVKYWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVK
IEDEDELKFLQRHVILESYWIGLSYDKKKKEWAWIHNGQSKLDMKIKKMNFTSRGCVFLS
KARIEDTDCNTPYYCICGKKLDKFPD
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagtgagcaggaggtcactttcccaactatgagattccacaagtcttcagggttgaac
agccaggtgagacttgaggggactcagagatctagaaaagctggcctaagagtgtgttca
gtcccttggcagctcattgtgatagctcttggaatcctctgttcccttcggctggtaatt
gttgcagtgtttgtgacaaagttttttcagtatagtcaacacaaacaagaaatcaatgaa
actctcaaccaccgccataactgcagcaacatgcaaagggatttcaacttaaaggaagaa
atgttgacaaataagtctatagattgtaggccaagctatgaacttctggaatacatcaaa
agagaacaggagagatgggacagtgaaaccaagagtgtttcagattcttcacgagacaca
ggcagaggtgttaaatactggttctgctatggtactaaatgttattatttcatcatgaat
aaaactacatggagtggatgtaaagcgaactgccagcattacagcgttcccattgtgaag
atagaagatgaagatgaactgaaattccttcaacgccatgttattctagagagttactgg
attggattgtcatatgataagaaaaaaaaggaatgggcatggattcacaatggccaatct
aaacttgacatgaaaataaagaaaatgaactttacgtctagaggatgtgtatttttatct
aaagcaagaatagaagatactgactgtaatactccctactactgtatttgtgggaagaaa
ctggataaattccctgattaa

DBGET integrated database retrieval system