KEGG   Mus musculus (mouse): 16641
Entry
16641             CDS       T01002                                 

Gene name
Klrc1, CD159, CD159a, NKG, NKG2, NKG2A, NKG2B
Definition
(RefSeq) killer cell lectin-like receptor subfamily C, member 1
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16641 (Klrc1)
   04612 Antigen processing and presentation
    16641 (Klrc1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    16641 (Klrc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16641 (Klrc1)
   04091 Lectins [BR:mmu04091]
    16641 (Klrc1)
CD molecules [BR:mmu04090]
 Proteins
  16641 (Klrc1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16641 (Klrc1)
SSDB
Motif
Pfam: Lectin_C Ly49 Chordopox_A33R
Other DBs
NCBI-GeneID: 16641
NCBI-ProteinID: NP_001129540
MGI: 1336161
Ensembl: ENSMUSG00000030167
Vega: OTTMUSG00000032510
UniProt: Q9Z202
Position
6; 6 F3
AA seq 244 aa
MSNERVTYAELKVAKNSRNQHRKPRGPRSSISVIEQEIIYSDFSFQNPSQEHPWICRNCP
CKGFPSPPEKLIAGTLGLICFVLIVAVVVITTVATPYTEAKAQINSSMTRTHRDINYTLS
SAQPCPHCPKEWISYSHNCYFIGMERKSWNDSLVSCISKNCSLLYIDSEEEQDFLQSLSL
ISWTGILRKGRGQPWVWKEDSIFKPKIAEILHDECNCAMMSASGLTADNCTTLHPYLCKC
KFPI
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagtaatgaacgcgtcacctatgcagaactgaaggtggcaaagaactcaaggaaccag
cacaggaaaccaaggggtcctcgcagctccatttcagtcatcgagcaggaaatcatctat
tcggacttcagctttcaaaatccttctcaggagcatccctggatctgcaggaattgcccc
tgcaaaggttttccatctcctccagagaaactcattgctggtaccctgggcctcatctgt
tttgtcttaattgtcgctgtggttgtaattactacagttgccacaccatataccgaagca
aaggcacagatcaattcctcaatgactagaacccacagagatataaactacactctatct
tcagcacagccttgtcctcattgtccaaaggagtggatatcatattctcacaattgttat
ttcattggtatggagagaaaatcttggaatgacagtttggtgtcctgcatttccaaaaac
tgtagtctgctttacatagatagtgaagaggagcaggattttctgcaatctctttcactg
atctcatggactggaatccttcggaagggcagaggtcagccctgggtctggaaagaagac
tcaattttcaaaccaaagatagcagagattctccatgatgaatgtaactgtgccatgatg
tcagcttctggtctcacagcagacaactgtacaactttacatccatatctttgtaagtgt
aaattccccatctga

DBGET integrated database retrieval system