KEGG   Mus musculus (mouse): 16641
Entry
16641             CDS       T01002                                 

Gene name
Klrc1, CD159, CD159a, NKG, NKG2, NKG2A, NKG2B
Definition
(RefSeq) killer cell lectin-like receptor subfamily C, member 1
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16641 (Klrc1)
   04612 Antigen processing and presentation
    16641 (Klrc1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    16641 (Klrc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16641 (Klrc1)
   04091 Lectins [BR:mmu04091]
    16641 (Klrc1)
CD molecules [BR:mmu04090]
 Proteins
  16641 (Klrc1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16641 (Klrc1)
SSDB
Motif
Pfam: Lectin_C Ly49 Chordopox_A33R
Other DBs
NCBI-GeneID: 16641
NCBI-ProteinID: NP_001129540
MGI: 1336161
Ensembl: ENSMUSG00000030167
Vega: OTTMUSG00000032510
UniProt: Q9Z202
Position
6; 6 F3
AA seq 244 aa
MSNERVTYAELKVAKNSRNQHRKPRGPRSSISVIEQEIIYSDFSFQNPSQEHPWICRNCP
CKGFPSPPEKLIAGTLGLICFVLIVAVVVITTVATPYTEAKAQINSSMTRTHRDINYTLS
SAQPCPHCPKEWISYSHNCYFIGMERKSWNDSLVSCISKNCSLLYIDSEEEQDFLQSLSL
ISWTGILRKGRGQPWVWKEDSIFKPKIAEILHDECNCAMMSASGLTADNCTTLHPYLCKC
KFPI
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagtaatgaacgcgtcacctatgcagaactgaaggtggcaaagaactcaaggaaccag
cacaggaaaccaaggggtcctcgcagctccatttcagtcatcgagcaggaaatcatctat
tcggacttcagctttcaaaatccttctcaggagcatccctggatctgcaggaattgcccc
tgcaaaggttttccatctcctccagagaaactcattgctggtaccctgggcctcatctgt
tttgtcttaattgtcgctgtggttgtaattactacagttgccacaccatataccgaagca
aaggcacagatcaattcctcaatgactagaacccacagagatataaactacactctatct
tcagcacagccttgtcctcattgtccaaaggagtggatatcatattctcacaattgttat
ttcattggtatggagagaaaatcttggaatgacagtttggtgtcctgcatttccaaaaac
tgtagtctgctttacatagatagtgaagaggagcaggattttctgcaatctctttcactg
atctcatggactggaatccttcggaagggcagaggtcagccctgggtctggaaagaagac
tcaattttcaaaccaaagatagcagagattctccatgatgaatgtaactgtgccatgatg
tcagcttctggtctcacagcagacaactgtacaactttacatccatatctttgtaagtgt
aaattccccatctga

KEGG   Mus musculus (mouse): 16643
Entry
16643             CDS       T01002                                 

Gene name
Klrd1, CD94
Definition
(RefSeq) killer cell lectin-like receptor, subfamily D, member 1
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16643 (Klrd1)
   04612 Antigen processing and presentation
    16643 (Klrd1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    16643 (Klrd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16643 (Klrd1)
   04091 Lectins [BR:mmu04091]
    16643 (Klrd1)
CD molecules [BR:mmu04090]
 Proteins
  16643 (Klrd1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16643 (Klrd1)
SSDB
Motif
Pfam: Lectin_C Ly49 Peptidase_C41
Other DBs
NCBI-GeneID: 16643
NCBI-ProteinID: NP_034784
MGI: 1196275
Ensembl: ENSMUSG00000030165
Vega: OTTMUSG00000032506
UniProt: O54707
Position
6 F3; 6 63.42 cM
AA seq 179 aa
MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCV
CLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMH
YSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagtttctaggatcactcggtggagactgatgtctgtcatctttggaataaaatgt
cttttcttgatggttactttgggagttttgctgataaattcatttactatacagaacatt
caatcaacaccttctccaaccaccactgtagaattccaggaagtttctgaatgctgtgtt
tgcctggacaagtgggttgggcatcagtgcaattgttactttatttccaaagaagaaaag
tcttggaaaagaagcagagatttctgtgcttcgcagaattccagccttcttcagccccaa
tccagaaatgaattgagttttatgaacttcagtcaaacctttttctggattggaatgcat
tatagtgaaaaaagaaatgcctggctatgggaggatggcacagttccctcaaaagattta
tttccagaattctcagttatcaggccagagcactgcattgtttacagtccaagcaaaagc
gtttctgctgaatcctgtgaaaataaaaaccgttacatctgtaagaaactgcctatttaa

KEGG   Mus musculus (mouse): 245615
Entry
245615            CDS       T01002                                 

Gene name
Kir3dl2, Ki, Kirl2
Definition
(RefSeq) killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    245615 (Kir3dl2)
   04612 Antigen processing and presentation
    245615 (Kir3dl2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    245615 (Kir3dl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    245615 (Kir3dl2)
CD molecules [BR:mmu04090]
 Proteins
  245615 (Kir3dl2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Ig_4 YajC DUF6377
Other DBs
NCBI-GeneID: 245615
NCBI-ProteinID: NP_808416
MGI: 3612791
Ensembl: ENSMUSG00000057439
Vega: OTTMUSG00000018684
UniProt: Q673W2
Position
X F1; X 58.45 cM
AA seq 388 aa
MLLWFLSLMCSGFFLVQRMSAHVGSHDKPFLYAWPSYVVPLGQNVTLTCDSHRGSNIFKL
YKEEGSPIPQLHETTFQKSQVFGPVTTEHAGTYRCFHPQYANVLSAHSEPLKIIISGIYL
KPFLLILQSPLVNSGGNVTLECHSENMFDTYILISHRMGIIKNSVQVSAEHHESGSHVTY
SIGPMTPDLVGTYTCYGANSYYPYEWSDPSDPIDIKITGVYKKPSLSVLMGPVLMMSGET
MTLSCISDHQFDMFHMSREGVPQGQGMPGVQIHSGKFEAKFLLSSMIQKGNYRCYGSFRN
SSHVWSSPSDPLYLPAKGNCPACTEEDPKIHNCKNLRILTGLLMTMVLVIIIIFYSCYFP
KQNKSQKQAAASMEQESEVKKHNKQTAF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctgctctggttcctcagcctcatgtgttctggtttcttcctagtccagaggatgtca
gcacacgtgggaagtcatgataaaccattcctatatgcctggccaagttatgttgttcct
ctgggacagaatgtgactcttacatgtgactctcatagaggatctaacatattcaaactg
tacaaagaagaagggtctccaatccctcagttacatgagactacatttcagaagagccag
gtctttggtcctgtgaccacagaacatgcaggaacctacagatgcttccatcctcaatat
gctaatgtattgtcagcacatagtgagcctctgaaaatcataatttcaggaatctacttg
aagcctttcctcttgattctacaaagtcccctggtgaattcaggagggaatgtgaccctg
gaatgtcactcagagaatatgttcgatacatacattttgatttcacacagaatgggaata
atcaagaactctgtccaagtttctgcagaacatcatgaaagtgggtcacatgtcacctac
tcaataggtcccatgacacctgaccttgttgggacttacacatgctatggtgctaacagt
tactacccctatgaatggtcagaccccagtgaccccattgacatcaagatcacaggtgta
tacaagaaaccttctctgtcagtcctgatggggcctgtgctgatgatgtcaggagaaacc
atgaccctgtcttgcatctctgaccatcagtttgacatgttccatatgtccagggaaggg
gtgcctcagggacaggggatgcctggagtgcagatccacagtggtaaattcgaggcaaaa
ttccttcttagttcaatgatccaaaaggggaactatagatgctatggctctttcaggaac
tcttcccatgtgtggtcctccccaagtgaccccttgtaccttcctgccaaaggaaactgt
cctgcatgcacagaagaagatcccaaaatacataactgcaagaacctgcgcattctaact
gggctcttaatgaccatggtccttgtcatcatcatcatcttttattcttgttactttccc
aaacagaataagtctcagaaacaagcagcagccagcatggaacaagagtctgaagttaaa
aaacacaataaacagacagctttctag

KEGG   Mus musculus (mouse): 245616
Entry
245616            CDS       T01002                                 

Gene name
Kir3dl1, Ki, Kirl1, Kirl2, Krl1
Definition
(RefSeq) killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    245616 (Kir3dl1)
   04612 Antigen processing and presentation
    245616 (Kir3dl1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    245616 (Kir3dl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    245616 (Kir3dl1)
CD molecules [BR:mmu04090]
 Proteins
  245616 (Kir3dl1)
SSDB
Motif
Pfam: ig Ig_3 DUF6377 Ig_2 ASFV_J13L Serinc TssO Ly49 YajC DUF2140 Chordopox_A13L Comm FAM176 EphA2_TM
Other DBs
NCBI-GeneID: 245616
NCBI-ProteinID: NP_001297619
MGI: 2652397
Ensembl: ENSMUSG00000031424
Vega: OTTMUSG00000016977
UniProt: Q673W4 D3Z751
Position
X F1; X 58.77 cM
AA seq 316 aa
MLLWFLSLVCSGFFLVQRMSAHLGIYMKPFLLILQSPLVDTGGNVTLECHSENMFDTYIL
ISHRMGIIKNSVQVSAEHHESGSHVSYSIGPMTPDLVGTYTCYGANSYYPYEWSDSSDPI
DIKITGIYKKPSLSALMGPVLMMSGETMTLSCISDHQFDTFHMSREGVPRGQGMPAVQSH
SGKFEAKFLLSPMIQKGNYRCYGSFRNASHVWSSPSDPLYLPAKGNCPAYTEADTKTNNY
KNLHILTGLLVTMVLVVIIIFYSCYFSKQNKSQKQAAASMEQEYEVKNTINTQDFERQEG
QGLHTQNLSRESSTKT
NT seq 951 nt   +upstreamnt  +downstreamnt
atgctgctctggttcctcagcctcgtgtgttctggtttcttcctagtccagaggatgtca
gcacacttgggaatctacatgaagcctttcctcttgattctacaaagtcccctggtggat
acaggagggaatgtgaccctggaatgtcactcagagaatatgttcgatacatacattttg
atttcacacagaatgggaataatcaagaactctgtccaagtttctgcagaacatcatgaa
agtgggtcacatgtcagctactcaataggtcccatgacacctgaccttgttgggacttac
acatgctatggtgctaacagttactacccctatgaatggtcagactccagtgaccccatt
gacatcaagatcacaggtatatacaagaaaccttctctgtcagccctgatgggccctgtg
ctgatgatgtcaggagagaccatgaccctgtcttgcatctctgaccatcagtttgacacg
ttccatatgtccagggaaggggtgcctcggggacaggggatgcctgcagtgcagagccac
agtggtaaattcgaggcaaaattccttcttagtccaatgatccaaaaagggaactataga
tgctatggctctttcaggaacgcttcccatgtgtggtcctccccaagtgaccccttgtac
cttcctgccaaaggaaactgtcctgcatacacagaagcagataccaaaacaaataactac
aagaacctgcacattctaactgggctcttagtaaccatggtccttgtcgtcatcatcatc
ttttactcttgttacttctccaaacagaataagtctcagaaacaagcagcagccagcatg
gaacaagagtatgaagttaaaaacacaataaacacacaggactttgaaagacaagaagga
caggggttacatacacagaacttgagcagagaatcttcaaccaaaacttga

DBGET integrated database retrieval system