KEGG   Mus musculus (mouse): 16642
Entry
16642             CDS       T01002                                 

Gene name
Klrc2, NKG2, NKG2C
Definition
(RefSeq) killer cell lectin-like receptor subfamily C, member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16642 (Klrc2)
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 16642
NCBI-ProteinID: NP_001092139
MGI: 1336162
Ensembl: ENSMUSG00000052736
Vega: OTTMUSG00000032508
UniProt: Q9WVJ7
Position
6; 6 F3
AA seq 213 aa
MSHLLGTEQASEPRKATKKTQAQFRFSNAAGDRLLEFSLQHASQKHLKASRHGYCKNFAS
PPEKLIAGILGTIWFTLLIALVISTRIVSPSQPCPHCPKEWISYSHNCYFIGMERKSWND
SLGSCLSKNCSLLHIDSEEEQDFLQSLSLVSWTGILRKGRGQAWDWKKDSIFKPKIAEIS
HDECNCAMMSASGLTADNCTTLHPYLCKCKFPI
NT seq 642 nt   +upstreamnt  +downstreamnt
atgagtcacctgcttggaactgaacaggcctcagaacccaggaaagccacaaagaaaacc
caggcgcagttccgtttcagtaatgcagcaggagatcgcctgctggagtttagccttcaa
catgcttcccagaagcatctgaaggccagcaggcatggctactgcaaaaattttgcatca
cctccagagaagctcatcgctggaatcctgggcaccatctggtttaccttattgattgct
ctagtaatctcaaccagaattgtttctccatcacagccttgtcctcattgtccaaaggag
tggatatcatattctcacaattgttatttcattggtatggagagaaaatcttggaatgac
agtttggggtcctgcctttccaaaaactgtagtctgcttcacatagatagtgaagaggag
caggattttctgcaatctctttcactggtctcatggactggaatccttcggaagggcaga
ggtcaggcctgggactggaaaaaagactcaattttcaaaccaaagatagcagagatttcc
catgatgaatgtaactgtgccatgatgtcagcttctggtctcacagcagacaactgtaca
actttacatccatatctttgtaagtgtaaattccccatctga

DBGET integrated database retrieval system