KEGG   Mus musculus (mouse): 16643
Entry
16643             CDS       T01002                                 

Symbol
Klrd1, CD94
Name
(RefSeq) killer cell lectin-like receptor, subfamily D, member 1
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16643 (Klrd1)
   04612 Antigen processing and presentation
    16643 (Klrd1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    16643 (Klrd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16643 (Klrd1)
   04091 Lectins [BR:mmu04091]
    16643 (Klrd1)
CD molecules [BR:mmu04090]
 Proteins
  16643 (Klrd1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   16643 (Klrd1)
SSDB
Motif
Pfam: Lectin_C Ly49 Peptidase_C41
Other DBs
NCBI-GeneID: 16643
NCBI-ProteinID: NP_034784
MGI: 1196275
Ensembl: ENSMUSG00000030165
Vega: OTTMUSG00000032506
UniProt: O54707
Position
6:129565055..129575738
AA seq 179 aa
MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCV
CLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMH
YSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagtttctaggatcactcggtggagactgatgtctgtcatctttggaataaaatgt
cttttcttgatggttactttgggagttttgctgataaattcatttactatacagaacatt
caatcaacaccttctccaaccaccactgtagaattccaggaagtttctgaatgctgtgtt
tgcctggacaagtgggttgggcatcagtgcaattgttactttatttccaaagaagaaaag
tcttggaaaagaagcagagatttctgtgcttcgcagaattccagccttcttcagccccaa
tccagaaatgaattgagttttatgaacttcagtcaaacctttttctggattggaatgcat
tatagtgaaaaaagaaatgcctggctatgggaggatggcacagttccctcaaaagattta
tttccagaattctcagttatcaggccagagcactgcattgtttacagtccaagcaaaagc
gtttctgctgaatcctgtgaaaataaaaaccgttacatctgtaagaaactgcctatttaa

DBGET integrated database retrieval system