KEGG   Mus musculus (house mouse): 16646
Entry
16646             CDS       T01002                                 
Symbol
Kpna1, AW494490, IPOA5, NPI1, Rch2, mSRP1
Name
(RefSeq) karyopherin (importin) alpha 1
  KO
K23940  importin subunit alpha-5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05132  Salmonella infection
mmu05164  Influenza A
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    16646 (Kpna1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    16646 (Kpna1)
  09172 Infectious disease: viral
   05164 Influenza A
    16646 (Kpna1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16646 (Kpna1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16646 (Kpna1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    16646 (Kpna1)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT V-ATPase_H_C RICTOR_V CTNNBL
Other DBs
NCBI-GeneID: 16646
NCBI-ProteinID: NP_032491
MGI: 103560
Ensembl: ENSMUSG00000022905
UniProt: Q60960
Position
16:35803692..35857506
AA seq 538 aa
MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQINNMEMAPGGVITSDMTDMIFSNSPEQQLSATQKFRKLLSKEPNPPIDE
VINTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRNVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLNCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgtccacaccaggaaaagagaactttcgcctgaaaagttacaagaacaaatctctgaat
cctgatgagatgcgcaggaggagggaggaagaaggactgcagttacggaagcagaaaaga
gaagagcagttattcaagagaagaaatgttgctacagcagaagaagaaacagaagaagaa
gttatgtctgatggtggctttcatgaggcccagataaataacatggagatggcaccaggg
ggtgtcatcacctctgacatgactgatatgatattctcgaatagcccagagcagcagctc
tctgcaacacagaagtttaggaaactactttcaaaagaacctaatcctccaattgatgaa
gtcatcaacacaccaggagtagtggccaggtttgtggagttcctcaaacgaaaagaaaat
tgtacactgcagtttgaatcagcttgggtcctgacaaatattgcttcaggaaactctctt
cagacccggaatgtgattcaggcaggagctgtgcctattttcatcgagttgcttagctca
gagtttgaagatgtccaggagcaggcagtttgggctcttggcaacattgctggagatagt
accatgtgcagggactatgtcttaaactgcaatatccttcctcctcttctgcagttattt
tcaaagcaaaaccgcttgaccatgacccggaatgcagtatgggctttatctaatctctgt
agagggaagagcccacctccagaatttgctaaggtttctccctgtctgaatgtcctttct
tggttactgtttgtcagtgacactgatgtactagctgatgcttgctgggctctctcatac
ctgtcagatggacccaatgataaaatccaagcagtcatcgatgcaggagtctgcaggagg
cttgtggaacttctgatgcataatgactataaagtagtttctcctgctttgcgggctgtg
ggaaacattgtcacaggggatgatattcagacacaggtaattttgaattgctcagctctt
caaagtttattgcatctgctgagtagcccaaaggaatctatcaaaaaagaagcctgttgg
acaatctctaatattacagctggaaatagggcacagatccagactgtgatagatgctaac
atgttcccagctcttattagtatattgcaaacagcagagttccggacaaggaaggaagct
gcttgggccatcacaaatgcaacttctggaggatcagctgagcagatcaagtacctagta
gaactgggttgtatcaagccactctgtgatctcctcactgtcatggatgcaaaaattgta
caggttgccctaaatggcttagaaaacatcctgaggcttggagaacaagaagccaaacga
aacggctcaggcattaatccttactgtgctttgattgaggaagcatatggtctggataaa
attgagttcttacagagtcatgaaaaccaggagatctatcaaaaggcttttgatcttatt
gagcattactttgggaccgaagatgaggacagcagcatcgcaccccaggttgatcttagc
cagcagcagtacatcttccagcagtgtgaagctcctatggaaggtttccagctttga

DBGET integrated database retrieval system