KEGG   Mus musculus (mouse): 16647
Entry
16647             CDS       T01002                                 

Gene name
Kpna2, 2410044B12Rik, IPOA1, PTAC58, Rch1
Definition
(RefSeq) karyopherin (importin) alpha 2
  KO
K15043  importin subunit alpha-1/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    16647 (Kpna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16647 (Kpna2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    16647 (Kpna2)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C ParcG Gcn1_N ECF-ribofla_trS
Other DBs
NCBI-GeneID: 16647
NCBI-ProteinID: NP_034785
MGI: 103561
Ensembl: ENSMUSG00000018362
Vega: OTTMUSG00000003580
UniProt: P52293 Q52L97
Structure
PDB: 

Position
11; 11 E1
AA seq 529 aa
MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDA
TSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGL
IPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE
QAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNK
NPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVK
LLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMS
NITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCG
IIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHE
NESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtccacgaacgagaatgctaacttaccagctgcccgacttaacaggttcaagaacaag
gggaaggacagcacagaaatgcgtcgccgccgaatagaagttaatgtggaactcaggaaa
gctaaaaaagatgagcagatgctgaaaagaagaaacgtcagctcctttcctgatgatgct
acttctccgctacaggaaaaccggaacaaccagggtactgtaaattggtctgttgaggac
attgttaaaggcataaacagtaacaatttggaaagccagctccaagctactcaagctgct
cggaaattgctttctagagagaaacagcctcctatagacaacatcatccgggctggtttg
atcccaaaatttgtgtccttcttgggcaaaactgattgtagtcctattcagtttgagtct
gcttgggcactcaccaacattgcttctggaacatctgaacagaccaaagctgtggtggat
ggaggtgctatcccagcgtttatttctctcttggcatctcctcatgctcacatcagcgag
caagctgtttgggctcttggaaacattgcaggtgatggttcagctttccgagacttagtt
atcaaacacggtgcgattgacccactgttggcacttcttgcagttcccgatctgtctacc
ttggcatgtggttacttacgtaatcttacctggacactttcaaacctttgtcgaaacaag
aaccctgcacctcccttagacgccgttgagcagattcttcctacgttagttcgactcctg
caccacaatgatccagaagtattggcagattcctgctgggccatttcctacctgactgat
ggtccaaatgagcgcattgagatggttgtgaagaaaggagttgttccccaacttgtgaag
cttctaggagctactgaactgcccattgtgactcccgcactaagagccatagggaatatt
gtcactggaacagatgagcagactcagaaagtgatcgatgcaggagcacttgcagtcttt
cccagcctgctaacaaaccccaaaactaatattcagaaggaggccacatggacaatgtcg
aacattacagctggacgccaggaccagatacagcaagttgtgaatcacggcctagtcccc
tttcttgttggtgtcctctctaaggcggactttaagacacagaaggaggccgcgtgggct
ataaccaactataccagcggtgggactgttgagcagattgtgtatctcgttcactgtggg
ataatagaacctttgatgaacctcctgagtgcaaaagataccaagattattcaggttatt
cttgacgccatttcaaatatctttcaggctgcagagaaactaggtgagacagaaaagctc
agtataatgattgaagagtgtggaggcttggataaaattgaagcactacagaggcatgaa
aacgagtctgtatacaaggcctcattgaacttaattgagaagtacttctcagtggaggaa
gaggaagatcaaaatgtggtgccagaaactacctctgaaggcttcgccttccaagttcag
gatggagctcctgggacctttaacttctaa

DBGET integrated database retrieval system