KEGG   Mus musculus (house mouse): 16649
Entry
16649             CDS       T01002                                 
Symbol
Kpna4, 1110058D08Rik, IPOA3, qip1
Name
(RefSeq) karyopherin (importin) alpha 4
  KO
K23583  importin subunit alpha-4/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05132  Salmonella infection
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    16649 (Kpna4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    16649 (Kpna4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16649 (Kpna4)
SSDB
Motif
Pfam: Arm Arm_3 HEAT_EZ IBB HEAT_2 HEAT Adaptin_N Cnd1 V-ATPase_H_C V-ATPase_H_N Arm_2 CTNNBL Mo25 MMS19_N DUF4042
Other DBs
NCBI-GeneID: 16649
NCBI-ProteinID: NP_032493
MGI: 1100848
Ensembl: ENSMUSG00000027782
UniProt: O35343 Q4FJX1
Position
3:complement(68979554..69034425)
AA seq 521 aa
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPQEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTEGFQF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggcggacaacgagaaattggacaaccaacggctcaagaattttaagaacaaaggccgt
gacttggagactatgagaagacaacgaaatgaagttgtagttgaattaaggaagaataaa
agagatgaacatctcttaaagagaaggaatgtaccacaagaagatatctgtgaagactcc
gatatagatggtgattatagagtgcaaaatacctctctagaagctattgttcaaaatgct
tcaagtgataaccaaggaattcaattaagtgcagttcaagctgctaggaagcttttatcc
agtgatcgaaatccaccaattgatgacttaataaaatctggaatattgcctattttagtt
cattgtcttgaaagagatgacaatccttctttacagtttgaagctgcgtgggctttgaca
aacattgcatctggaacgtctgaacaaacgcaagcagtggttcagtccaatgctgtgcca
cttttcttgaggcttctgcattcaccccatcagaatgtctgtgaacaggcagtatgggcg
ttgggaaacatcataggtgatggacctcagtgtagagattatgtgataagtcttggagtt
gtaaaacctctgctttcattcataagtccatctattcctataacattcttaagaaatgtt
acctgggttatggtcaatttatgtcgccacaaagacccaccaccaccaatggagacaatt
caggagattcttccagctctttgtgtattaattcatcacacagatgtaaatatcctggta
gatactgtctgggccctgtcttaccttacggatgctggcaatgaacagatacagatggta
atagactctggcatagttcctcacttggttccgctactcagccaccaggaagttaaagtt
cagactgctgcactgcgagctgtgggcaacattgtcactggaactgatgagcaaacacaa
gtagttttaaactgtgatgctctctcacacttcccagcactcctcactcatcccaaagag
aaaattaataaagaagcagtgtggttcctctccaacatcactgcaggaaatcaacagcag
gttcaggcagtaattgatgccaatcttgtaccaatgataatacaccttttggataaggga
gattttggcactcagaaagaagctgcctgggccataagtaacttaacaatcagcggaagg
aaagaccaagtggcctatcttatccaacaaaatgttattccacctttttgcaatttgctg
actgtaaaagatgcacaagttgtgcaagtagtacttgatggactaagtaatatattaaaa
atggctgaagatcaagcagaaaccatagccaatctcatagaagaatgtggtggactggag
aaaattgaacaacttcagaatcatgaaaatgaggacatctacaaattggcctatgagatc
attgaccagttcttctcttcagatgatattgatgaagatcctagccttgttccagagtca
gttcaaggtggaacatttggtttcaattcatcgaccaatgtaccaacagaggggttccag
ttttag

DBGET integrated database retrieval system