KEGG   Mus musculus (house mouse): 16650
Entry
16650             CDS       T01002                                 
Symbol
Kpna6, IPOA7, Kpna5, NPI-2
Name
(RefSeq) karyopherin subunit alpha 6
  KO
K15042  importin subunit alpha-6/7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05164  Influenza A
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    16650 (Kpna6)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    16650 (Kpna6)
  09172 Infectious disease: viral
   05164 Influenza A
    16650 (Kpna6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16650 (Kpna6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    16650 (Kpna6)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 HEAT V-ATPase_H_C Arm_2 CTNNBL
Other DBs
NCBI-GeneID: 16650
NCBI-ProteinID: NP_032494
MGI: 1100836
Ensembl: ENSMUSG00000003731
UniProt: O35345 Q8BH30
Position
4:complement(129537772..129566560)
AA seq 536 aa
METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA
AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI
NTPGVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF
EDVQEQAVWALGNIAGDSSLCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRG
KNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV
ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTI
SNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKRSGSGVNPYCGLIEEAYGLDKIE
FLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggagaccatggcaagcccagggaaggacaattatcgaatgaagagctataagaacaat
gccttaaaccctgaggaaatgagacgaaggagggaggaagagggcattcagcttcggaaa
cagaagcgggaacaacaactttttaaacggagaaatgtagagctgattaatgaagaagct
gccatgtttgatagtctgctgatggattcctacgtgagctctacaactggggagagcgtg
atcacgagagagatggtagagatgctcttctcggacgactctgacttgcagttagcaacc
acgcagaaattccggaaactcctgtccaaagagccgagtcctccaatagatgaagttatt
aacactccaggagtagttgatcggtttgtggagtttctgaagagaaatgagaattgtaca
ttgcagtttgaagctgcctgggctctaacaaacattgcctctggaacgtctcagcagacc
aaaattgtcattgaagcaggagctgtccccatttttatagagttacttaactcagacttt
gaagatgtacaagaacaggcagtgtgggcgcttggaaacatcgctggagatagctcgctt
tgcagggattatgtcttgaattgctccatccttaaccccttgttaacactccttactaag
tccacacgactgacaatgacacggaatgcagtctgggccctgtcaaacctctgccgaggc
aagaaccctcctccagagtttgcaaaggtctctccttgtttgcctgtattgtcccgactg
ctcttcagcagtgactcagacttgctggcagatgcttgctgggccctctcctacctgtct
gatggccccaatgagaagatccaggcagtcatagactctggagtctgccggagattggta
gagcttctgatgcacaacgattacaaagtggcgtctcctgccttgagagctgtgggtaat
attgtcactggggatgacatccagacccaggtcattcttaattgttcagccctcccttgc
ctcctccacctactgagcagctctaaggaatcaatccggaaggaagcttgctggaccatt
tcaaacatcactgctggcaacagggctcaaatacaggctgtcatagatgcaaacatcttc
cctgtattgattgaaatccttcagaaagcagagttccgtacaaggaaagaagcagcctgg
gccatcaccaacgccacatcaggaggaactcctgagcaaatcaggtacctggtatcactg
ggctgcattaagcccctgtgtgacttgctgactgtaatggattcaaaaattgtgcaagtg
gccctcaatggactagagaacattcttcggcttggagagcaagaaagcaagcgtagtggc
tcaggggtcaatccctactgtggcctcatcgaggaagcctatggcttggataaaattgag
tttctccagagccacgagaaccaggaaatctaccagaaggcctttgacctcattgagcac
tactttggtgtagaggatgacgacagcagcctggctcctcaggtggatgagacgcaacag
cagttcatcttccagcagcctgaggcccccatggagggcttccagctataa

DBGET integrated database retrieval system