KEGG   Mus musculus (mouse): 16658
Entry
16658             CDS       T01002                                 

Gene name
Mafb, Kreisler, Krml, Krml1, kr
Definition
(RefSeq) v-maf musculoaponeurotic fibrosarcoma oncogene family, protein B (avian)
  KO
K09036  transcription factor MAFB
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    16658 (Mafb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16658 (Mafb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    16658 (Mafb)
SSDB
Motif
Pfam: bZIP_Maf Maf_N KASH_CCD bZIP_1 HOOK APC_N_CC DUF4164 UPF0449 bZIP_2 Vta1 DUF2353 MbeD_MobD Uso1_p115_C Spc24 JIP_LZII
Other DBs
NCBI-GeneID: 16658
NCBI-ProteinID: NP_034788
MGI: 104555
Ensembl: ENSMUSG00000074622
Vega: OTTMUSG00000001175
UniProt: P54841
Structure
PDB: 
2WT7 4AUW 2WTY

Position
2 H2; 2 80.92 cM
AA seq 323 aa
MAAELSMGQELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPL
STPCSSVPSSPSFSPTEPKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQP
LQSFDGFRSAHHHHHHHHPHPHHGYPGAGVTHDDLGQHAHPHHHHHHQASPPPSSAASPA
QQLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLK
QKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK
LANSGFREAGSTSDSPSSPEFFL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgcggagctgagcatggggcaagagctgcccaccagcccgctggccatggagtac
gtcaacgacttcgaccttctcaagttcgacgtgaagaaggagcccctggggcgcgcggag
cgtccgggccggccatgcacacgcctgcagcctgctggctcggtgtcgtccaccccgctc
agcactccgtgcagctccgtgccttcttctcccagcttcagtccgactgaaccgaagacc
catctcgaggacctgtactggatggcgagcaactaccagcagatgaaccccgaggcactc
aacctgacgcccgaggacgcggtggaggcgctcatcggttcgcacccagtgccccagccg
ctgcagagcttcgacggcttccgtagtgcgcaccaccatcaccaccaccaccaccctcat
ccgcaccacgggtacccaggagcaggtgtgactcacgatgacctgggccagcacgctcac
ccgcaccatcaccatcatcaccaagcgtcgcccccgccgtccagcgctgccagtcccgcg
caacagctacccactagccacccggggccgggaccgcacgcaacagccgcggcgacggct
gcgggcggcaacggtagtgtggaggaccgcttctctgatgaccagctggtgtccatgtcg
gtgcgtgagctgaaccgccacctgcggggcttcaccaaggacgaggtgatccgcctgaag
cagaagcggcggaccctgaagaaccggggctacgcccagtcgtgcaggtataaacgcgtc
cagcagaaacatcacctggagaacgagaagacgcagctcattcagcaggtggagcagctt
aagcaggaggtgtcccggctggcccgcgagagagacgcctacaaggtcaagtgcgagaaa
ctcgccaactccggcttcagggaggcgggctccaccagcgacagcccctcctctcctgag
ttctttctgtga

DBGET integrated database retrieval system