KEGG   Mus musculus (house mouse): 16663
Entry
16663             CDS       T01002                                 
Symbol
Krt13, CK13, K13, Krt-1.13, Krt1-13
Name
(RefSeq) keratin 13
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16663 (Krt13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16663 (Krt13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16663 (Krt13)
   04147 Exosome [BR:mmu04147]
    16663 (Krt13)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16663 (Krt13)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16663 (Krt13)
  Exosomal proteins of other body fluids (saliva and urine)
   16663 (Krt13)
  Exosomal proteins of colorectal cancer cells
   16663 (Krt13)
  Exosomal proteins of melanoma cells
   16663 (Krt13)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 DUF4686 ATG16 Keratin_2_head Bacillus_HBL Jnk-SapK_ap_N Prefoldin RasGAP_C DUF1664
Other DBs
NCBI-GeneID: 16663
NCBI-ProteinID: NP_034792
MGI: 101925
Ensembl: ENSMUSG00000044041
UniProt: P08730
Position
11:complement(100008153..100012392)
AA seq 437 aa
MSCRFQSSSMSYGGGFGAGSCQLGGGRNISSCSSRFVTGGSAGGYGGGMSCGFGGGAGGG
FGGGFGGGFGGSYGGGFGGGFGDFGGVDGGLLSGNEKITMQNLNDRLASYLDKVRALEAA
NADLEVKIRDWHLKQSPASPERDYSAYYKTIEELRIKILEATTDNNRIILEIDNARLAAD
DFRLKYENELTLRQSVEADINGLRRVLDELTLAKTDLEMQIESLNEELAYLKKNHEEEMK
EFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEALAEKNRRDAEEWFQTKSAELNKEVS
SNAEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYALQLQQIQGLIS
SIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMTGFNSGGNNTTT
SNGSPSSNSGRPDFRKY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgagctgccgcttccagagttcctccatgagctatggaggtggtttcggagctggttct
tgccagcttggaggaggccgtaatatctcctcctgctcatctcggtttgtcactggaggg
tcagctggaggctatggagggggcatgagctgtggctttggtggaggagctggtggtggc
tttggaggtggctttggaggtggctttggaggtagctatggcggaggttttggcggtggc
tttggtgacttcggaggtgtcgatggtggcctcctctctggcaacgagaagatcaccatg
cagaacctcaatgaccgcctggccagctacctggataaggtgcgcgccttggaggcagcc
aatgccgacctggaggtgaagattcgtgactggcatctgaaacagagcccagctagtcca
gagcgggactacagtgcttattataagaccatcgaggagctccggatcaagattctggaa
gccaccacggacaacaaccggatcatcctggagattgacaatgccaggctggctgcagat
gacttcaggctcaagtacgaaaatgagctgaccttgcgccagagcgtggaggccgacatc
aacggcctgcgcagggtgctggatgagctgactctggctaagactgacctggaaatgcag
attgagagcctgaatgaagaactggcttacctgaagaagaaccacgaagaggagatgaag
gaattcagcaaccaggtagtaggccaggtcaatgtggagatggacgccacccctggcatt
gatctgacccgtgtgctggctgagatgagggagcagtatgaagccctggcagagaagaat
cggagggatgctgaggaatggttccagaccaagagtgcagagctgaacaaggaagtatcc
tccaacgctgaaatgatccagaccagcaagacagagatcacagaactcaggcgcacactc
cagggcctggagattgagctgcagtcccagctgagcatgaaagccggcctggaaagtacg
ttggcagagacagagtgccgctacgccctgcagctgcaacagatccaggggctcatcagc
agcatcgaggctcagctgagcgagctccgaagtgagatggagtgccagaaccaggaatac
aagatgctgttggacatcaaaacaaggctggaacaggagatcgccacctaccgcagcctg
ctagagggccaggatgctaagatgaccggcttcaactccggaggaaataacactactacc
tccaacgggtccccctcctccaattccggtcgcccagatttccgaaagtattaa

DBGET integrated database retrieval system