KEGG   Mus musculus (house mouse): 16666
Entry
16666             CDS       T01002                                 
Symbol
Krt16, AI324768, CK-16, K16, Krt1-16
Name
(RefSeq) keratin 16
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16666 (Krt16)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16666 (Krt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16666 (Krt16)
   04147 Exosome [BR:mmu04147]
    16666 (Krt16)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16666 (Krt16)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16666 (Krt16)
  Exosomal proteins of other body fluids (saliva and urine)
   16666 (Krt16)
  Exosomal proteins of colorectal cancer cells
   16666 (Krt16)
  Exosomal proteins of melanoma cells
   16666 (Krt16)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Sec2p
Other DBs
NCBI-GeneID: 16666
NCBI-ProteinID: NP_032496
MGI: 96690
Ensembl: ENSMUSG00000053797
UniProt: Q9Z2K1 Q3SYP5
Position
11:complement(100136917..100139728)
AA seq 469 aa
MATCSRQFTSSSSMKGSCGIGGGSSRMSSILAGGSCRAPSTCGGMSVTSSRFSSGGVCGI
GGGYGGSFSSSSFGGGLGSGFGGRFDGFGGGFGAGLGGGLGGGIGDGLLVGSEKVTMQNL
NDRLATYLDKVRALEEANRDLEVKIRDWYQRQRPTEIKDYSPYFKTIEDLKSKIIIATQE
NAQFTLQIDNARLAADDFRTKYENELFLRQSVEGDINGLRKVLDELTLSRADLEMQIENL
REELAFLKKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDV
EAWFLRKTEELNKEVASNSDLIQSNRSEVAELRRVFQGLEIELQSQLSMKASLENSLEET
KGRYCMQLSQIQGLISSVEEQLAQLRCEMEQQSQEYNILLDVKTRLEQEIATYRRLLDGE
NIHSSSQHSSGQSYSSREVFSSSSRQPRSILKEQGSTSFSQSQSQSSRD
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggccacctgcagccgccagttcacctcctccagctccatgaagggctcctgtggcatc
ggtggtggctctagccgcatgtcctccatcctggctggaggatcctgccgggctcccagc
acctgcgggggcatgtcagttacctcctctcgcttctcctctgggggagtctgtgggatt
ggaggtggctatggtgggagcttcagcagcagcagttttggtggaggacttggtagtgga
tttggtggtcgatttgatggatttggtggtggttttggtgctggtcttggtggtggtctt
ggcggtggtattggtgatgggctcctggtgggcagtgagaaagtgaccatgcagaacctc
aatgaccgcctggccacctacctggacaaggtgcgtgccctggaagaggccaacagagac
ctggaggtgaagatccgggactggtaccagaggcagcggcccactgagatcaaagactac
agcccctacttcaagaccattgaggacctgaagagcaagatcattattgccacccaggag
aatgcacagttcactttgcagattgacaatgccaggctggcagctgatgacttcaggacc
aagtacgagaatgagctgttcttgcggcagtccgtggagggtgacatcaatggcctgcgc
aaggtgctagatgagctgaccctgtccagagctgacctggaaatgcagattgaaaacctc
agagaagagctggccttcctgaagaagaaccatgaggaggagatgcttgccttgaggggt
cagactggtggggacgtcaatgtggagatggacgcagcccccggtgtggacctcagccgc
attctgaatgagatgagggaccagtatgagcagatggcagagaagaaccgcagagatgtg
gaggcctggttcctgagaaagactgaggagctgaacaaagaggtggcctctaacagtgat
ctaatccagagcaaccgcagcgaggtggctgagctccgcagggtgttccagggcctggag
attgaactgcagtcccagctcagcatgaaagcatccttggagaacagcctagaagagacc
aaaggcagatactgtatgcagctgtcccagatccagggtttgatcagcagtgtggaggag
cagctggctcagcttcgctgcgagatggagcagcagagccaggagtacaacatcttgttg
gatgtgaagacaaggctggagcaggagatcgccacctaccgccgtctgctggatggcgag
aatatccactcctcctcacagcactcctctggacagtcctattcttctcgagaagtcttc
tcctcatcctcccgccagccccggtccatcctcaaggagcaaggttcaaccagcttcagc
cagagccaaagtcagagttccagggactaa

DBGET integrated database retrieval system