KEGG   Mus musculus (mouse): 16668
Entry
16668             CDS       T01002                                 

Symbol
Krt18, CK18, K18, Krt1-18
Name
(RefSeq) keratin 18
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16668 (Krt18)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16668 (Krt18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16668 (Krt18)
   04147 Exosome [BR:mmu04147]
    16668 (Krt18)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16668 (Krt18)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16668 (Krt18)
  Exosomal proteins of other body fluids (saliva and urine)
   16668 (Krt18)
  Exosomal proteins of colorectal cancer cells
   16668 (Krt18)
  Exosomal proteins of melanoma cells
   16668 (Krt18)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 DUF4407 Laminin_II SpoIVA_middle
Other DBs
NCBI-GeneID: 16668
NCBI-ProteinID: NP_034794
MGI: 96692
Ensembl: ENSMUSG00000023043
UniProt: P05784
Position
15:101936651..101940461
AA seq 423 aa
MSFTTRSTTFSTNYRSLGSVRTPSQRVRPASSAASVYAGAGGSGSRISVSRSVWGGSVGS
AGLAGMGGIQTEKETMQDLNDRLASYLDKVKSLETENRRLESKIREHLEKKGPQGVRDWG
HYFKIIEDLRAQIFANSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVESDIHGLRK
VVDDTNITRLQLETEIEALKEELLFMKKNHEEEVQGLEAQIASSGLTVEVDAPKSQDLSK
IMADIRAQYEALAQKNREELDKYWSQQIEESTTVVTTKSAEIRDAETTLTELRRTLQTLE
IDLDSMKNQNINLENSLGDVEARYKAQMEQLNGVLLHLESELAQTRAEGQRQAQEYEALL
NIKVKLEAEIATYRRLLEDGEDFSLNDALDSSNSMQTVQKTTTRKIVDGRVVSETNDTRV
LRH
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagcttcacaactcgctccaccaccttctccaccaactaccggtccctgggctctgtg
cgaactcccagccagcgggtccggcctgccagcagcgcagccagcgtctatgcaggtgct
gggggctccgggtcccggatatccgtgtcccgctctgtctggggtggctctgtggggtcc
gcaggcctggcgggaatgggtggaatccagaccgagaaggagaccatgcaagacctgaac
gatcgcctggccagctacctagacaaggtgaagagcctggaaactgagaacaggagactg
gagagcaaaatccgggaacatctggagaagaaggggccccagggcgtcagagactggggc
cactacttcaagatcatcgaagacctgagggctcagatctttgcgaattctgtggacaat
gcccgcatcgtcttgcagatcgacaatgcccgccttgccgccgatgactttagagtcaag
tatgagacagaactagccatgcgccagtctgtggagagcgacatccatggactccgcaag
gtggtagatgacaccaacatcacaaggctgcagctggagacagaaatcgaggcactcaag
gaagaacttctgttcatgaagaagaatcatgaagaggaagtccaaggtctggaagcccag
attgccagctctggattgactgtggaagtggatgcccccaaatctcaggacctcagcaag
atcatggcggacatccgcgcccagtatgaagcgctggctcagaagaaccgcgaggaactg
gacaagtactggtctcagcagattgaggagagtaccacagttgtcaccaccaagtctgcc
gaaatcagggacgctgagaccacactcacggagctgagacgcaccctccagaccttggag
attgacttggactccatgaaaaaccagaacatcaacttggagaacagcctcggggatgtg
gaggcccgatacaaggcacagatggagcagctcaatggggtccttctgcatctggagtca
gagctggcacaaactcgggcagagggccagcgccaggcccaggaatatgaagccctcttg
aacatcaaggtgaagcttgaggcagagattgccacctaccgccgcttgctggaggatgga
gaagatttcagtctcaacgatgccctggactccagcaactccatgcaaactgtgcagaag
acaactacccgtaagatcgtggatggcagagtggtgtccgagactaatgacaccagagtt
ctgaggcactga

DBGET integrated database retrieval system