KEGG   Mus musculus (mouse): 16672
Entry
16672             CDS       T01002                                 

Gene name
Krt34, 4733401E01Rik, Ha2, K34, Krt1-, Krt1-4
Definition
(RefSeq) keratin 34
  KO
K07604  type I keratin, acidic
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    16672 (Krt34)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    16672 (Krt34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16672 (Krt34)
   04147 Exosome [BR:mmu04147]
    16672 (Krt34)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16672 (Krt34)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16672 (Krt34)
  Exosomal proteins of other body fluids (saliva and urine)
   16672 (Krt34)
  Exosomal proteins of colorectal cancer cells
   16672 (Krt34)
  Exosomal proteins of melanoma cells
   16672 (Krt34)
SSDB
Motif
Pfam: Filament ERM
Other DBs
NCBI-GeneID: 16672
NCBI-ProteinID: NP_081839
MGI: 1309994
Ensembl: ENSMUSG00000043485
Vega: OTTMUSG00000002178
UniProt: Q9D646
Position
11 D; 11 63.38 cM
AA seq 392 aa
MSCESCLPALSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNEKETM
QFLNDRLASYMEKVRQLERENAELECRIQERNQQQDPLVCPAYQAYFRTIEELQQKILCA
KSENARLVVQIDNAKLASDDFRTKYQTELSMRQLVEADINSLRRILDELTLCKSDLEAQV
ESLREELLCLKKNHEEEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEALVETNR
REVEEWFTTQSEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHCMRNSLENTL
TESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCNLPCNPCATTNASGSCCGPCGSSKRCC
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcctgtgagtcttgcctgcccgccctgagctgccgcaccagctgctcctcccggccc
tgcgtgccccccagctgccatggctgcaccctgcccggggcctgcaacatccccgccaat
gtgggcaactgcaattggttctgtgagggctccttcaatggcaatgagaaggagaccatg
cagttcctgaatgaccgcctggcctcctatatggagaaggtgaggcagctggagagagag
aatgcagagctggaatgtaggatccaggagaggaaccagcagcaggaccccctggtgtgt
cctgcctaccaggcctacttcaggaccattgaggagctgcagcagaagattctgtgtgct
aagtctgagaacgccaggctggtcgtgcagatcgacaatgccaagctggcctctgatgac
ttcaggaccaagtaccagactgagctgtccatgaggcagctggtggaggctgacatcaac
agcctgcgcaggatcctggatgagctgaccctctgcaagtctgacttggaggctcaggtg
gagtctctgagggaggagctgctgtgcctcaagaagaaccacgaggaggaagtcaacacc
ctgcgctgccagcttggagaccgcctcaacgtggaggtggacgctgctcccaccgtggac
ctgaaccgagtgctcaacgagaccaggtgtcagtacgaggccctggtggaaaccaaccgc
cgggaagtggaggaatggttcaccacacagtcagaggagctgaacaagcaggtggtgtcc
agctcagagcagctacagtcctgccaggctgagatcatcgagctaagacgcacagtcaac
gccctggagatcgagctgcaggcccagcactgcatgagaaactctctggagaacaccctg
acagagagtgaggctcgctacagctctcagctgtcccaggtgcagtgcctgatcaccaac
gtggagtctcagcttggtgagatccgggctgacctggagcgtcagaaccaggagtaccag
gtgctgctggatgtccgggccaggctggagtgtgagatcaacacgtacaggagcctgctg
gagagcgaggactgcaacctcccctgcaacccatgcgccaccaccaatgctagtggcagt
tgctgtggaccttgcggcagctcaaagcgttgctgttaa

DBGET integrated database retrieval system