KEGG   Mus musculus (mouse): 16678
Entry
16678             CDS       T01002                                 

Symbol
Krt1, Krt-2.1, Krt2-1, Krt86
Name
(RefSeq) keratin 1
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16678 (Krt1)
   04147 Exosome [BR:mmu04147]
    16678 (Krt1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16678 (Krt1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16678 (Krt1)
  Exosomal proteins of other body fluids (saliva and urine)
   16678 (Krt1)
  Exosomal proteins of colorectal cancer cells
   16678 (Krt1)
  Exosomal proteins of bladder cancer cells
   16678 (Krt1)
SSDB
Motif
Pfam: Filament Keratin_2_head Keratin_2_tail TPR_MLP1_2 FapA She9_MDM33 Alanine_zipper DUF948 DUF745 Tropomyosin_1 SAT SesA CENP-F_leu_zip DUF1664 Metal_resist YscO DUF4407 ISG65-75
Other DBs
NCBI-GeneID: 16678
NCBI-ProteinID: NP_032499
MGI: 96698
Ensembl: ENSMUSG00000046834
UniProt: P04104
Position
15:complement(101753861..101759221)
AA seq 637 aa
MSLQCSSRSLCRGGGGSRNFSSGSAGLVSFQRRSTSSSMRRSGGGGGGRFSGGGFCGSSG
SGFGSKSLMNLGGGRSISKSVAGGGGSFCGGFGGGSYGGGGFGGGSYGGGGFGGGSFGGG
GFGGSGFGGGLGGGGGFGSGGGFGGGRFGSMGPVCPPGGIQEVTINQSLLQPLNVEVDPQ
IQKVKSQEREQIKSLNDKFASFIDKVRFLEQQNQVLQTKWELLQQVDTTTRTQNLDPFFE
NYISILRRKVDSLKSDQSRMDSELKNMQDLVEEYRTKYEDEINKRTNAENEFVTIKKDVD
SAYMTKVELQAKADALQQDIDFFSALYQMEMSQMQTQISETNVVLSMDNNRSLDLDGIIS
EVKAQYDSICQRSKAEAETFYQSKYEELQITAGKHGDSVRNTKMEISELNRMIQRLRSEI
DGCKKQISQIQQNINDAEQRGEKALKDAQNKLNEIEDALSQCKEDLARLLRDFQELMNTK
LALDMEIATYKKLLEGEEIRMSGECTPNVSVSVSTSHTSMSGSSSRGGGSGGGRYGGGGS
YGGGSGGGSYGGSSGGGGSGGSYGGGSGGGSYGGGSGGGSSGSHRGGSGGGGGSSGGSYG
GSSGGGRGGSSSGGGGVKSSGSSTVKFVSTSYSRGTK
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgagtctacagtgtagctccaggtccctgtgccgcggtggcggtggcagcaggaacttc
agctcaggctctgctggcctagtcagcttccagcgcagatccaccagcagctctatgcgc
cgcagcggtggaggtggtggtgggagattttcaggaggaggcttctgtgggagttctggt
agtggctttggaagtaagagtcttatgaaccttggaggcggtaggagcatctccaagagt
gtggctggaggtggtggcagcttctgtggtggctttgggggtggcagctacggcggtggt
ggctttgggggtggcagctacggcggtggtggctttgggggtggcagcttcggcggtggt
ggctttggagggagtggttttggcggaggtcttggtggtggtggtggttttggtagtgga
ggtggttttggtggtggtagatttggtagtatggggcctgtctgtccccctggtggcatc
caggaagtgaccatcaaccaaagccttctgcaacccctcaacgttgaggttgaccctcag
attcaaaaagtgaagtctcaggagagagagcagatcaagtcactcaatgacaagtttgcc
tccttcatcgacaaggtgcgcttcctagagcaacaaaaccaggtgctacaaaccaaatgg
gagctgctgcagcaggtagacaccacaacccggacccaaaacttagaccctttttttgag
aactatatcagcatcctcagaaggaaggtggactcgctgaagagtgaccagtcacggatg
gattctgagctgaagaacatgcaagacctggtggaagagtacaggaccaagtacgaggat
gaaatcaacaagaggaccaacgcagagaatgagttcgtgaccatcaagaaggatgtggat
tcagcttacatgaccaaagttgagcttcaggccaaggcagatgccctccagcaagacatt
gacttcttctctgcactctaccaaatggaaatgtctcagatgcaaactcaaatcagcgaa
accaatgttgtcctgtccatggacaacaaccgcagtttggatctggatggcatcatctcg
gaagtcaaggcccagtatgatagcatttgccagaggagcaaggctgaagctgagaccttt
taccagagcaagtacgaagagctgcagatcactgctggcaaacatggagacagtgtgaga
aataccaagatggagatttctgagctgaatcgaatgatccagagacttcgatctgaaatt
gatggttgcaagaagcagatctcccaaatacagcagaacatcaatgatgctgagcagcgt
ggtgagaaagcactcaaagatgcccagaacaagctgaatgagatagaggatgcattgtcg
caatgcaaggaggatcttgccagattgctgcgtgacttccaggagctgatgaacactaag
ctggccctggacatggagattgccacatacaagaaacttctggaaggagaggagatcagg
atgtctggagagtgcactcccaacgtgagcgtgtcggtgagcaccagccacaccagcatg
agcggaagcagtagccgaggcggcggcagcggcggcggcagatacggaggcggtggcagt
tatggcggcggctctggaggcggcagctacggcggcagttctggaggcggaggcagtggt
ggcagctacggcggcggctccggaggcggcagctacggcggcggctccggaggcggcagc
agtggaagccacagaggtggctctggagggggcggtggcagctccggaggcagctacggt
ggctcctctggcggaggccggggaggatccagctcaggtggcggtggcgttaagtcctct
ggcagttctaccgtgaagtttgtttccaccagttactcccgagggaccaaataa

DBGET integrated database retrieval system