KEGG   Mus musculus (mouse): 16680
Entry
16680             CDS       T01002                                 

Symbol
Krt84, AV235125, HRb-1, Krt2-16, Krt2-3
Name
(RefSeq) keratin 84
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16680 (Krt84)
   04147 Exosome [BR:mmu04147]
    16680 (Krt84)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16680 (Krt84)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16680 (Krt84)
  Exosomal proteins of other body fluids (saliva and urine)
   16680 (Krt84)
  Exosomal proteins of colorectal cancer cells
   16680 (Krt84)
  Exosomal proteins of bladder cancer cells
   16680 (Krt84)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 CENP-F_leu_zip ADIP Crescentin CATRA-C BRE1 DUF5082 YusW Fib_alpha DUF1192
Other DBs
NCBI-GeneID: 16680
NCBI-ProteinID: NP_032500
MGI: 96700
Ensembl: ENSMUSG00000044294
UniProt: Q99M73
Position
15:complement(101433461..101441255)
AA seq 603 aa
MSCRSYRVSSGRRVGSFSSCSAMAPQHLNRFRSSSVSCRSGPGFRGLGGFGSRSVINFGS
SSPRIAVGCSRPVRCGVGFGAGSGMAFGSGDGLGFRASSGVGLGFGAGGCPSYGFGGPGF
GGPGFGGPGFGYRIGGIGGPSAPAITAVTVNQSLLTPLNLEIDPNAQRVKRDEKEQIKTL
NNKFASFIDKVRFLEQQNKLLETKWSFLQEQKCARSNLEPLFDNYITNLRRQLDVLSSDQ
ARLQAERNHLQDILEGFKKKYEEEVVFRANAENEFVALKKDVDAAFLNKSDLEANVDTLI
QETEFLKALYHEEIEMLQSHISETSVIVKMDNSRDLNLDGIIAEVKAQYEEVARRSRADV
ESWYQTKYEEMRVTAGQHCDNLRSTRDEINELTRLIQRLKAEIEHTKAQCAKLEAAVAEA
EQQGEAALNDAKCKLADLEGALQQAKQDMARQLREYQELMNVKLALDIEIVTYRRLLEGE
EIRICEGVGPVNISVSSSRGGVLCGPELVSGSSLSHNGGVTFSTSSSIRATGGVLASSSL
RAGGDLLSSGSRGGSVLVGDACAPSIPCALPTEGGFSSCSGGRGNRSSSVRFSSTTTSRR
TRY
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgtcttgccgctcctacagagtcagctctggccgtcgggtgggaagcttcagttcttgc
tcagcaatggcccctcagcatctgaaccgcttccggtccagctctgtctcctgcaggagt
gggcctggcttccggggcttgggtggttttggtagtcggagcgtcatcaactttggatca
tcctcaccccggatagcagttggatgctctcgtcctgtccgctgtggagttggctttgga
gctggcagtgggatggcctttggatctggtgatggcctgggctttagggccagcagcggt
gttggcctggggtttggggctggcggctgccctagctatggattcggaggccctggattc
ggaggccctggctttggtggccctggctttggctacagaatcggaggaattggaggccca
tcagcccccgctatcacagctgtaactgttaaccagagcctgctgacacccctcaacctg
gagattgaccccaatgcccagagggtgaagagagacgaaaaggagcagatcaagaccctc
aacaacaaatttgcctccttcattgataaggtgaggtttctggagcaacagaataaactc
ctagagaccaagtggagcttcctccaagaacagaaatgtgcccggagcaatctggagcct
ctcttcgataactatatcaccaacctgcggaggcagctggatgtcctaagcagtgaccag
gctcggctgcaggcagagaggaaccacctgcaagacatccttgagggcttcaagaagaag
tatgaagaggaggtggtattccgggccaatgccgagaatgagtttgtagcgctgaagaag
gatgtagatgcagctttcctgaacaaatctgatctggaagccaatgtggatactctgatc
caggaaactgaattcctgaaggctctctaccatgaggaaatcgagatgctgcaatcacac
atatcagagacatctgtcatcgtgaagatggacaacagccgggatctgaacctagatggg
atcatagctgaagtcaaggcacagtatgaggaggtggcgaggcggagtcgtgcagatgtg
gagtcgtggtaccagaccaagtatgaggagatgcgggtgaccgctggccagcactgtgac
aatctacgtagcacacgggacgagatcaatgaactgacccggttgatccagaggctgaaa
gcagagatcgagcataccaaggctcagtgtgccaaactggaggctgctgtggctgaggca
gagcagcagggtgaagcagccctcaatgatgccaagtgcaagctggctgatctggagggt
gccctgcagcaggccaagcaggacatggccaggcagctgcgggagtaccaggagctcatg
aatgtcaagctggccctggacatcgagattgtcacctacaggaggctgctggagggcgag
gaaattcggatctgcgaaggagttgggccagtaaacatatctgtgagcagctctcgagga
ggtgtgctgtgtgggcccgagttagtctctggatccagcctttcccacaatggtggagtc
accttctccaccagcagcagcatccgtgccaccggaggggttctggcttcctcaagcctg
agggctggtggggacctgctgagctctgggtccagaggaggctcagtgctggtgggtgat
gcctgtgcccccagcatcccctgtgcactgcccactgagggaggcttcagtagctgcagt
ggtggtcgtggtaacaggagctccagcgtccgcttctcatctaccaccacctcccgcagg
accaggtactga

DBGET integrated database retrieval system