KEGG   Mus musculus (mouse): 16682
Entry
16682             CDS       T01002                                 

Symbol
Krt4, AW108092, K4, Krt-2., Krt-2.4, Krt2-, Krt2-4
Name
(RefSeq) keratin 4
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16682 (Krt4)
   04147 Exosome [BR:mmu04147]
    16682 (Krt4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16682 (Krt4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16682 (Krt4)
  Exosomal proteins of other body fluids (saliva and urine)
   16682 (Krt4)
  Exosomal proteins of colorectal cancer cells
   16682 (Krt4)
  Exosomal proteins of bladder cancer cells
   16682 (Krt4)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 CENP-F_leu_zip ADIP ATG16 DUF1664 Spc7 DUF812 Baculo_PEP_C Alanine_zipper Rx_N Tropomyosin_1 Fez1 DUF1192 Golgin_A5 TraC
Other DBs
NCBI-GeneID: 16682
NCBI-ProteinID: NP_032501
MGI: 96701
Ensembl: ENSMUSG00000059668
UniProt: P07744
Position
15 F2; 15 57.13 cM
AA seq 525 aa
MIARQSSVRGASRGFSSGSAIAGGVKRVAFSSGSMSGGAGRCSSGGFGSRSLYNLGGHKS
ISMSVAGSCQGGGYGGAGGFGVGGYGAGFGAGGFGGGFGGSFNGRGGPGFPVCPAGGIQE
VTINQSLLTPLQVEIDPEIQKIRTAEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNL
LQQQTTTTSPKSLDPFFETYINALRKNLDTLSNDKGRLQSELKMMQDSVEDFKTKYEEEI
NKRTAAENDFVVLKKDVDAAYMIKVELEAKMESLKDEINFTRVLYEAELAQMQTHVSDTS
VVLSMDNNRNLDLDGIIAEVRAQYEDIARKSKAEVESWYQIKVQQLQMSADQHGDSLKTT
KNEISELNRMIQRLRAEIENIKKQSQTLQASVADAEQRGELALKDAYSKRAELETALQKA
KEDLARLLRDYQALMNVKLALDVEIATYRKLLEGEECRMSGECKSAVSISVVGGSASIGG
SGLGLGSGFCSGSGSGSGFGFGGGIYGGSGSKITSSATITKRSPR
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgatcgccagacagtcaagtgtccgcggagcctcccggggctttagcagtggctcagct
attgctggtggtgtcaagcgagtggcctttagctcaggctccatgtctggcggtgcaggg
cgctgctcttctgggggcttcggcagcagaagtctttacaacctcgggggtcacaagagt
atctccatgagcgtggctgggtcctgccaaggcggcggctatgggggtgccggaggcttc
ggcgttggaggatacggtgctgggtttggtgccggtggttttggcggtggctttggaggc
tccttcaacggtcgaggaggtcctggcttcccagtctgtcctgctggaggtattcaggaa
gtcaccatcaaccagagcctgctgacacctcttcaggtggagattgacccagagatccag
aaaatccgcacggcggagcgtgagcagatcaagaccctcaacaacaaattcgcgtccttc
atcgataaggtgcgattcttagagcaacagaacaaggtcctggagaccaaatggaacctc
ctccagcagcagacaaccaccacatctcccaaaagcctggatcctttctttgagacttac
atcaacgccttgaggaagaacctggacactttgagcaatgacaaaggtcgcctacagtca
gagctaaagatgatgcaggacagtgtggaggacttcaagaccaagtatgaagaggagatc
aacaagcgtacagctgcagagaatgacttcgtggtcctcaagaaagatgtggatgctgcc
tacatgatcaaggtggagttagaggccaagatggaaagccttaaggatgagatcaacttc
acgagagtcctctatgaagcggagctggcccagatgcagacacatgtctcagacacatct
gtagtgctgtccatggacaacaaccggaacctggacctggatggcatcatcgcagaggtc
cgggcccagtatgaggacattgctaggaagagcaaggctgaggttgaatcctggtaccag
atcaaggtccagcagctccagatgtcagctgaccaacatggagatagcctgaagaccacc
aagaatgagatctcagaactcaacaggatgatccagaggctgcgggcagagattgagaac
atcaagaagcagagccagactctgcaggcatctgtggctgatgcagagcagcgtggagag
ctggccctcaaagatgcctacagcaaacgcgcagaactggagactgcactgcagaaggcc
aaggaggacctggcccggctgctgagggactaccaggctctcatgaacgtcaagctggcc
ctggatgtggagattgccacctacaggaagctgctggagggcgaggagtgcaggatgtct
ggagaatgcaagagtgctgtgagcatctcggtagttggcggcagcgccagcattggcggc
agtggccttggcctgggtagcggtttttgctccggttctggttctggaagtggctttgga
tttggtggtggcatttatggcggttctggttccaagatcacctcttccgccaccatcacc
aagaggtccccacgatag

DBGET integrated database retrieval system