KEGG   Mus musculus (mouse): 16691
Entry
16691             CDS       T01002                                 

Symbol
Krt8, AA960620, AL022697, AU019895, Card2, EndoA, K8, Krt-2.8, Krt2-8
Name
(RefSeq) keratin 8
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16691 (Krt8)
   04147 Exosome [BR:mmu04147]
    16691 (Krt8)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     16691 (Krt8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16691 (Krt8)
  Exosomal proteins of other body fluids (saliva and urine)
   16691 (Krt8)
  Exosomal proteins of colorectal cancer cells
   16691 (Krt8)
  Exosomal proteins of bladder cancer cells
   16691 (Krt8)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 CENP-F_leu_zip TolA_bind_tri CALCOCO1 ABC_tran_CTD DivIC ADIP Crescentin FPP NT5C Taxilin Baculo_PEP_C ATG16 BRE1 DUF3450
Other DBs
NCBI-GeneID: 16691
NCBI-ProteinID: NP_112447
MGI: 96705
Ensembl: ENSMUSG00000049382
UniProt: P11679
Position
15:complement(101905146..101912777)
AA seq 490 aa
MSIRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSMGTGVGLGG
FGGAGVGGITAVTVNQSLLSPLKLEVDPNIQAVRTQEKEQIKSLNNKFASFIDKVRFLEQ
QNKMLETKWSLLQQQKTSRSNMDNMFESYINNLRRQLEALGQEKLKLEAELGNMQGLVED
FKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQIHEEEIRE
LQSQISDTSVVLSMDNSRSLDMDGIIAEVRAQYEDIANRSRAEAETMYQIKYEELQTLAG
KHGDDLRRTKTEISEMNRNINRLQAEIEALKGQRASLEAAIADAEQRGEMAIKDAQTKLA
ELEAALQRAKQDMARQLREYQELMNVKLALDIEITTYRKLLEGEESRLESGMQNMSIHTK
TTSGYSGGLSSSYGGLTSPGFSYGMSSFQPGFGSAGGSNTFSRTTKAVVVKKIETRDGKL
VSESSDVVSK
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtccatcagggtgactcagaaatcctacaagatgtccacctccggtccccgggccttc
agcagccgctcgttcacgagtggacccggtgcccgcatcagctcttccagcttttcccgg
gtgggcagcagcagcagcagcttccggggaagcatgggcaccggcgtgggtctgggcggc
tttggcggggctggtgtcgggggcatcacagccgtcacggtgaaccagagcctgttgagc
cccttgaagctggaggtggaccccaacatccaggctgtgcgcactcaggagaaggagcag
attaaatccctgaacaacaagttcgcctccttcattgacaaggtgcgcttcctggagcag
cagaacaagatgctggagaccaagtggagcctgttgcagcagcagaagacgtcgaggagc
aacatggacaacatgtttgagagctacatcaacaacctccgccggcagctggaagccctg
ggccaggagaagctgaagctggaggctgagcttggcaacatgcagggcctggtggaggac
ttcaagaataagtatgaggatgagatcaacaagcgtacagagatggagaatgaatttgtc
ctcatcaagaaggatgtggacgaagcatacatgaacaaggtggaactagagtcccgcctg
gaaggactgaccgacgagatcaacttcctccggcagatccatgaagaggagatccgtgag
ttgcagtctcagatctcagacacgtctgtggtgctgtctatggacaacagccgctccctg
gacatggatggcatcatcgctgaagttcgtgcccagtacgaggacattgccaatcgcagc
cgagctgaggctgaaaccatgtaccagattaagtatgaggaattgcagaccctggctggg
aagcacggggatgatctgcgccgcacaaagacagagatctccgagatgaaccgcaacatc
aaccgcctgcaggcggagattgaagccctcaaaggccagagggcatcgttggaggcagcc
atcgctgatgctgagcagcgtggggagatggccattaaggatgcccagaccaagctggct
gagctggaggctgccctgcaacgggccaagcaggacatggccaggcagctgcgcgagtac
caggagcttatgaacgtcaagctggccctggacatcgagatcaccacctaccgcaagctg
ctggagggggaggagagcaggctggagtctgggatgcagaacatgagcattcatacgaag
accaccagcggctactcaggaggactgagttcatcctatgggggactcactagccctggc
ttcagctacggaatgagctccttccagcccggcttcggttctgccgggggatccaacact
ttcagccgcaccaccaaggctgtggttgtgaagaagattgaaacccgagatgggaagctg
gtgtccgagtcttctgatgtcgtgtccaagtga

DBGET integrated database retrieval system