KEGG   Mus musculus (mouse): 16709Help
Entry
16709             CDS       T01002                                 

Gene name
Ktn1
Definition
(RefSeq) kinectin 1
  KO
K17975  kinectin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    16709 (Ktn1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    16709 (Ktn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 16709
NCBI-ProteinID: NP_032503
MGI: 109153
Ensembl: ENSMUSG00000021843
Vega: OTTMUSG00000045014
UniProt: Q61595 F8VQC7
Position
14; 14 C1
AA seq 1327 aa AA seqDB search
MELYESTYFVVLIPSVVITVIFLFFWLFMKETLYDEVLAKQKREQKLISTKTDKKKAEKK
KNKKKEIQNGTLRESDSEHVPRDFKLSDASPAEDEQFVPAPLNVAETSSSVRERKKKEKK
QKPSLEEQVIKESDASKIPGKKVEPVLVTKQPAPPPPLEAAALKKKAGQKKSKNGSEEQD
KKVEMLMAPSKEQDVLLSHQDTKQEGGLGKKKGLSKKQKSENVAVLVDEPLIHATTYIPL
DNANSNLMMDKREIIDMIKPDHVEGIQKSGTKKLKIETDKENAEVKFKDFLLSLKTMMFS
EDEALCVVDLLKEKSGVIKEALKKSNKGELSGLLHQLQEKERLLSAMKEDAAASKERCKQ
LTQEMMTEKERSSVVIARMKDRIGTLEKEHNIFQNKMHASYQETQQMQMKFQQVQEQMEA
EIAHLKQENGILRDAVSNTTNQLESKQSAELNKLRQDCGRLVSELNEKTGKLQQEGVQKK
NAEQAATQLKVQLQEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSLHSKLT
DTLVSKQQLEQRLMQLMESEQKRASKEESLQIQVQDILEQNEALKAQIQQFHSQIAAQTS
ASVLAEELHKVIAEKDKQLKQTEDSLANEQDHLASKEEELKDVQNMNFLLKAEVQKLQAL
ANEQAATAHEVEKMQKSIHVKEDKIRLLEEQLQHEVASKMEELKILSEQNKALQSEVQKL
QTAVSQQPNKDVVEQMEKCIQEKDEKLRTVEELLETGLIQVATREEELSAIRTENSTLTR
EVQELKAKQSDQVSFVSLIEDLKRVIHEKDGQIKSVEELLEVELLKVANKEKTVQALKQE
IEVLKEEIGNAQLEKAHQLSVTSQVQELQNLLRGKEEQVNSMKAALEDRDRDLRGRGTCA
QVCSTPQFEELESVLKEKDNEIKRIEVKLKDTESDVSKMSELLKEVQEENKFLKCQLSHQ
KHQQASFPSQEELQTVISEKEKEITDLCNELESLKNAVEHQRKKNNDLREKNWEAMEALA
STEKMLQDRVNKTSKERRQHVEAIELESKDLLKRLFPTVSVPSNLNYSEWLRGFEKKAKA
CVAGTSDAEAVKVLEHRLKEASEMHTLLQLECEKYKSVLAETEGILQKLQRSVEQEESKW
KIKADESQRMIKQMQSSFTASERELERLRQENKDMENLRREREHLEMELEKAEMERSTYV
MEVRELKDLLTELQKKLDDSYSEAVRQNEELNLLKTQLNETHSKLQNEQTERKKVADDLH
KAQQSLNSIHSKISLKAAGDTVVIENSDISPEMESPEKETMSVSLNQTVTQLQQLLQEVN
QQLTKET
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtacgagtcaacgtattttgttgtcctcatcccttcagtagttattaccgtc
attttccttttcttctggcttttcatgaaagaaacattatatgatgaagttcttgcaaaa
caaaaaagagagcaaaagttgatttctacaaaaacagataaaaagaaggcagaaaagaag
aagaataaaaagaaagaaatccagaatgggacccttcgtgaatctgattctgagcacgtg
cctcgggactttaaattatccgatgcttctcccgcggaggatgaacagtttgtacctgct
ccactgaatgtggcagaaacttccagtagtgttagggaaagaaagaagaaggagaagaaa
caaaaaccttcccttgaagagcaggtcatcaaagaaagtgatgcatcaaagatcccaggc
aaaaaagtggaacctgtcctagttaccaaacagccggccccacccccacccctcgaagca
gctgccttgaagaagaaagcagggcagaagaagtctaaaaatggaagcgaagagcaagat
aaaaaggtggaaatgctgatggcaccttcaaaagagcaggacgtgttgctttcccatcaa
gacactaagcaagaaggtggactaggaaagaagaaaggcttgtcaaagaagcaaaagtca
gaaaatgttgcagtcttggtagacgagccccttattcatgcaactacttacattcctttg
gataatgctaactcaaatctcatgatggataagagagaaattattgatatgattaaacct
gatcatgttgaaggaatccagaaatctggaacaaaaaagctgaagattgaaactgacaaa
gaaaatgctgaagtgaaatttaaagatttccttctgtccttgaagactatgatgttttct
gaagatgaagctctttgtgttgtagacctgctgaaggaaaagtctggtgtgataaaagaa
gctttaaagaagtcgaataaaggagaactgagtggtcttctgcatcaacttcaggagaag
gagaggctgctctctgccatgaaggaagatgctgctgcctcaaaggagcgctgtaagcag
ttgactcaggaaatgatgacagagaaagaaagaagcagtgttgttatagcaagaatgaaa
gatcggattggaacactagaaaaggaacacaatatatttcaaaacaaaatgcatgccagt
taccaagagactcagcagatgcagatgaagtttcagcaagttcaggaacaaatggaagca
gagatagctcatttgaagcaggaaaatggtatcctgagagatgctgtcagtaacactaca
aaccaactggaaagcaagcaatccgcagagctaaataaactgcgccaagactgtgggagg
ctggtgagtgaactgaacgagaagacaggaaagctgcagcaagagggagtccagaagaag
aatgcggagcaagctgctacccagctcaaggttcaactgcaagaagctgagaggcgctgg
gaagaagttcagagctacatcaggaagaggacggcggagcatgaggctgcccagcaagat
ttacaaagtaaatttgtggccaaagaaaatgaagtccagagtctacatagtaagctcaca
gacaccttggtatcaaaacagcaattggagcaaagactaatgcagttgatggaatccgag
caaaagagggcgagcaaagaagagtctctgcagatccaagtgcaggatattttggaacaa
aacgaggctttgaaagctcagattcaacaattccattcccagatagcagctcagacctcc
gcttcagttctagcagaagaattacataaagtgattgcagaaaaggacaagcagctaaag
cagactgaagattcattagcgaatgaacaggatcacttagcaagcaaggaggaggagctt
aaggatgtacagaatatgaatttcttattaaaagctgaagtgcagaaattgcaggccctg
gctaatgagcaggctgctaccgcacatgaggtggagaagatgcagaagagtattcacgta
aaggaagataaaataagactgcttgaggagcagctgcagcacgaagttgccagcaaaatg
gaagaattgaagattctgagtgagcagaataaagcattacagtcggaagttcagaaactg
cagaccgctgtttctcagcagcctaataaagatgttgtggaacaaatggaaaaatgcatt
caagaaaaagatgagaagttaaggactgtggaagaattactggagactggactcattcag
gtggccaccagagaggaggagctgagtgccataagaacagagaactccaccctgaccaga
gaagttcaagagttgaaggctaagcagagcgatcaggtttcttttgtgtctctaattgaa
gatcttaagagagtgatccatgagaaagatggacagatcaagtctgtggaagagcttcta
gaagttgaacttctcaaagttgcaaataaggagaaaactgtccaggctttgaaacaggaa
atagaggttctaaaagaagaaataggaaatgcccagcttgaaaaggctcaccagctgtct
gtcacttctcaagtccaggagctgcagaacttattaagaggcaaggaagagcaggtgaac
agcatgaaggctgccttagaagacagggacagagacctgagagggagagggacgtgcgca
caggtgtgttcgacaccacaatttgaagaacttgaaagtgtgttgaaagaaaaggacaat
gaaattaagagaatagaagttaaattaaaggacacggagagtgatgtttctaagatgtca
gagctattaaaggaggtacaagaggaaaataaattccttaagtgccagctcagtcaccag
aagcaccaacaggcatcttttccctctcaggaagaattacaaacagtaatttcagaaaaa
gagaaagaaataactgatctctgcaatgagttagagtctttgaagaatgctgttgaacac
cagaggaagaaaaacaatgaccttcgggagaaaaactgggaagcaatggaagctttggca
tcaactgaaaaaatgctgcaggacagagtgaacaagacttccaaggaaagacggcaacac
gtggaagctattgagttagagtccaaagaccttctgaagaggttatttccaacggtgtct
gtcccttctaatttgaattacagtgaatggttgcgtggctttgaaaagaaggcaaaagcg
tgcgtagctggaacttcagacgcagaggcggtcaaggttttggagcacagattgaaagaa
gctagtgagatgcacactttgctacagctggaatgtgaaaaatacaagtcggtccttgca
gaaacagaagggattttgcaaaaacttcagcgaagtgtggagcaagaagaaagtaaatgg
aaaattaaagctgacgagtctcaaaggatgattaaacagatgcagtcctccttcacagcc
tcagagcgagagctagagcgactaagacaagaaaacaaagatatggagaatctgagaaga
gaaagagagcatttggaaatggagctagagaaggccgagatggagcgatcgacttacgtg
atggaagtcagagagctgaaagatctgttgactgagttgcagaaaaagcttgatgattca
tattctgaagcagtaagacagaatgaagagcttaacttgctcaagacacagttaaatgaa
acacactcaaaacttcaaaatgaacaaacggagagaaagaaggtagctgatgatttgcat
aaggctcaacagtccctgaactctatccactcaaaaatctcactgaaagctgctggagac
actgttgttattgagaacagtgatatttccccagaaatggagtctcctgagaaagagacg
atgtctgtaagtctcaatcagactgtgacacagttacagcaattgcttcaggaagtaaat
caacaactcacaaaggagacataa

DBGET integrated database retrieval system