KEGG   Mus musculus (house mouse): 16716
Entry
16716             CDS       T01002                                 
Symbol
Ky, CD1, D9Mgc44e
Name
(RefSeq) kyphoscoliosis peptidase
  KO
K24456  kyphoscoliosis peptidase [EC:3.4.-.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16716 (Ky)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     16716 (Ky)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C110
   16716 (Ky)
SSDB
Motif
Pfam: Transglut_core
Other DBs
NCBI-GeneID: 16716
NCBI-ProteinID: NP_077253
MGI: 96709
Ensembl: ENSMUSG00000035606
UniProt: F8VQF8
Position
9:102382954..102423438
AA seq 661 aa
MELKKDSNAVAIDMLLIVHSEKRRAAQATHLDPQANPGALLQNRGGFQGVRNGIRKWQEL
EENSFQGNLPEKQCLQQPQVITSYDNQGTQLTVEIHPQDAMPQLLKKFSLAKRLQGDKNG
NMRPRQPGGKDAHAYPWDRSSLKSMPLDLRLFEKLDASASQVTVKSGLNELVSDLLQEAH
SDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAG
VQCVTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHLVDSTWGSGLVDTTTSKFTFL
YNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSM
IRTVNGKATITIESRAPTLFMFMLNGKQEHGLLSLRKNGMKLEVYPPTMGTHKLQIFAKG
NSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGPSWFSEQMGITKPSHSDPIIHTSDGRC
AISFSVEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVK
KRQEQGNFIFVFNYLLCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLPANRNIAFKLK
LHGIAKALVKGQDTWPLTLNPEGYWEGSCNTAGCQEVYVMVLENANHNFYSYILKYKVND
Q
NT seq 1986 nt   +upstreamnt  +downstreamnt
atggagctgaagaaggacagcaacgctgtggccatcgacatgctgctcatcgtgcactcc
gagaagcggcgcgcggcgcaagccacgcacttggacccgcaggcgaacccgggcgcgctg
ctgcaaaaccgaggaggattccaaggtgtcagaaacggaatccggaagtggcaagagttg
gaagaaaacagctttcagggaaacttgccagagaagcagtgccttcagcagccgcaggtc
atcacctcctacgacaaccaaggtactcagctgactgtggaaatccacccccaagacgcc
atgccccagctgcttaagaagttctctttggctaaacgtttacaaggtgataaaaatgga
aacatgagaccccggcagcctggagggaaagatgcccacgcctacccctgggacagatcc
agtttgaaatccatgcccctggacctccggctctttgaaaaactggatgcctctgcctca
caggtgacagtcaagagtggcctgaatgagctggtgagtgacttgctccaggaagcccac
agcgatctggaaagggtcagagccatctggatctggatctgccaccatatagagtacgac
gttgaggctgcccaggagaaggaccgccaggccttcaaacccactgacatcctgaggacc
cagaagaccaactgtgatggttacgccggcctctttgaaaggatgtgcagggttgctggt
gtgcagtgtgtcaccgtgcctggctactccaagggctttggctaccagaccggccaaagc
ttctccggagagttcgaccacgcctggaacgctgtgtaccttgagggtcgttggcacctg
gtggacagcacctggggcagcggcctggtggacaccaccacctccaaattcaccttcctc
tacaatgaattctacttcctcacccaccccgccctgttcatcgaggatcacttcccagac
aacaaaaactggcagctgctgaagccgccccagtctctgaggcagtttgagaacagcatg
taccacaagagtgaattctacaacaagggcatgctgagcgcccacccggagacgtccatg
atcagaacagtcaatgggaaagccacaatcaccatcgagagccgggccccaacactgttc
atgttcatgctcaatggcaagcaggagcacgggctcctgagcctcaggaagaacgggatg
aagctggaggtgtaccctccaaccatgggcacccacaagctgcagatcttcgccaagggc
aactctgaaatctacagctcggtgctagaatacacactcaagtgcaactatgtagacttc
tctgtccagctgcccagtgagctccaccagcccgtgggccccagctggttctcggagcag
atgggcatcacgaagccctctcactctgaccctatcattcacaccagcgatggccgctgc
gccatcagctttagcgtggaagagggcgtcagtgtcctggcatcccttcatggcgatgac
ggccccatcactgaggagacacagcggcgctacatcttccagttgaaccgagggaagagg
accgagctcaaagtccagctgccccatgccggcaagtttgcccttaagatctttgtgaag
aagaggcaggaacaagggaacttcatctttgtcttcaactacctcttgtgctgcgccaac
accaaggtgaactggcccatgttccctgagagctttggcaactggggacaggacaatgaa
ctgctagagcctctctccggtgtgcttcccgccaaccgcaacatagccttcaaactaaag
ctgcatggtatcgccaaagctctggtgaaaggacaggacacgtggcccctcactcttaac
cccgagggctactgggagggcagctgcaacacagctggctgccaggaagtctacgtcatg
gtgctagagaatgctaaccacaacttctacagctacatcctgaaatacaaagtgaatgac
cagtga

DBGET integrated database retrieval system