KEGG   Mus musculus (mouse): 16764
Entry
16764             CDS       T01002                                 

Gene name
Aff3, 3222402O04Rik, A730046J16, LAF-4, Laf4
Definition
(RefSeq) AF4/FMR2 family, member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    16764 (Aff3)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     16764 (Aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 16764
NCBI-ProteinID: NP_001277743
MGI: 106927
Ensembl: ENSMUSG00000037138
Vega: OTTMUSG00000019698
UniProt: D3YYI6
Position
1 B; 1 16.58 cM
AA seq 1229 aa
MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRSQETQQDSGSFNSGYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFGAESRAQP
QPSTVCSTASSTPAAVPVQQGKRGAMGWQKAGHPPSDGQQRAAQQGSLRTLLGDGVGRQQ
TRAKQVCNMETGLQTQERPPAMAAKHGGSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSTETAVHCTAYRGVPANKPESARAKAKLAKFSIPKQAEESRSGENNS
CVEEIIREMTWLPPLSAIQAPAKVEPSKFPFPNKDSQLVSSGHSNPKKADAEPGSPDNGA
SNTSTLEDDLKLSSDDEEGEQQAAQRTALRALADSSVVQQTNCRGSAPSSKGGGSSSSSG
GSSSSSDSESTSGSDSETESSSSSSESEGSKPPHCSSPEAEPASSNKWQLDKWLNKVNPH
KPPILIQNESHGPERNQYYTPPVKDEGQDCGKLPEICQASLRDKELKTTCKEEQRPRTAN
KAPGSKSVKQKSPPAAVAVTAAALPPAVPSAPTESAPAPTRRSAGKKPTRRTERTSAGDG
ANCHRPEEPVAPDTLGASVVGPLEPPKTRPCGNNRTGHRKELRSSVTCEKRRTRGLSRIV
PKSKEFIETESSSSSSSSDSDLESEQEEYVLSKAPTTTGSEQRLKEAASSNNNSNSNSST
SRASVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRI
PEHLSQEPGVLSAPSAKDTDSAPASHALDAPAEKTLPKSKRKRKCDNEDDYREIKKVQGR
KESASRLAASTNNTLSGNHCNVNVNSLAIPINKNEKMLRSPTSPLSDTCKHKYASEDLTS
SSRPHGNGLLTSASSNKEPKAESQLQTIAGDLTKASHNSSENGTLHSKSRPQTEPWSPGS
NGHRDCKRQKLIFDDMPRSADYFMREAKRMKHKADAMVEKFGKALNYAEAALSFIECGNA
MEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFR
LKRDHAVKYSKALIDYFKNSSKAAQAPSPWGSSGKSTGSPSPMSPNPSPASSVGSQGSLS
SSSGLSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMG
PVTLHSSMEHLVQYSQQGLHWLRSSVHLS
NT seq 3690 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtgtgtctat
gaaccggacaggaatgcgttacggaggaaagagcgagaaagaagaagtcaagaaacacag
caggacagtggcagctttaactccggttactcgctcttcagcgaaccctacaagacgaac
aagggggatgaactctccaaccggatccagaatacattaggaaattatgatgagatgaaa
gactttttaactgatagatccaaccagagtcatcttgttggcgtccccaagccaggtgtc
cctcagactcccgtgaacaagatagatgagcattttggggcagagtcgagagcccagccc
cagccctcaaccgtctgcagcactgcgtcctctacacctgcagctgtccctgtgcagcag
ggcaagagaggtgccatgggctggcagaaggctgggcacccaccgtccgatggccaacag
agagcagcgcaacagggctctctcaggaccttgcttggagatggtgttggcagacagcag
acaagggccaagcaagtgtgcaatatggagacggggcttcagacccaggagaggccacct
gcaatggcagccaagcacggcggcagtggacactgtgttcagaactttcccccatccctg
gcttcaaaacccagcctggtgcagcagaaaccaactgcctacgtgcggccaatggatggc
caggaccaagctcctgacgaatctcctaagctgaagtcatccacagaaactgctgtgcac
tgcacagcctacagaggggtcccggccaacaaaccagagtcagcccgagccaaggccaag
cttgccaagttcagcatccccaagcaggcagaggagagtagatctggagaaaacaacagc
tgtgtggaagaaataattcgggagatgacctggcttcctccactttctgctattcaagct
cctgccaaagtggaaccaagcaagttcccattcccaaataaggactcgcaacttgtatcc
tctggacacagtaatccaaagaaagctgatgcggagccagggagtccagacaatggcgca
tcgaacacttcaactctggaagacgaccttaagctaagcagtgatgacgaagagggtgag
cagcaggcagcccagagaacagctctccgcgctctagctgacagctccgtggttcagcag
accaactgtagaggttcggcgccatccagcaagggcggcggcagcagcagcagcagcggc
ggcagcagctcctccagcgactcagagagcacttccggctccgactccgagacggagagc
agctccagctccagcgagagcgagggcagcaagcctccgcactgctccagccccgaggcc
gaacctgcgtcctctaacaagtggcagctggataaatggctaaacaaagttaatcctcac
aagccgccaattctgatccaaaatgaaagccacggcccggaaaggaatcaatactacacg
ccgccggtgaaagatgaagggcaagactgcgggaaacttcctgagatctgccaagccagc
ctgagggacaaggagctcaagaccacctgcaaggaggagcagaggccgaggaccgcaaac
aaggcccctggcagcaaaagtgtaaagcagaagtccccacccgctgctgtggctgtgacc
gcagctgccctcccgcccgcggtgcccagcgcacccacggagagcgcgcctgcgcccacc
cgcaggtcagcaggcaagaagcccacccggcgcaccgagaggacctcagccggggacggt
gccaactgccaccggcctgaggagccagtggccccagacacgctgggggcgagcgtggtg
ggacccctagagccccccaaaaccagaccctgcggtaacaacaggacaggccaccgcaag
gagctgcgctcctccgtgacctgtgagaagcggcgcacgagggggctgagcagaatcgtc
cccaaatccaaggagtttattgaaacagaatcttcgtcttcctcttcctcctcggactca
gacctggagtcagagcaagaggagtacgtcctgtccaaggctccgaccaccactgggagc
gagcagcggctgaaggaggccgccagcagcaacaacaacagcaacagcaacagcagcacc
tcccgggcttctgtgggctccatcaacgccaggaccaccagtgacattgccaaggagcta
gaggaacagttctacacgctggtcccctttggcaggaatgaactactatctccgctaaag
gacagcgatgaggtcaggtctctctgggtcaaaattgacctgaccctcctgtccaggatc
ccagaacacctgtcccaggagcctggggttttgagtgctccttcggccaaggacactgat
agtgccccagccagtcatgcattagacgctcctgctgaaaagactttgccaaaatccaag
aggaaacgcaagtgcgacaacgaagatgactacagggagataaagaaggtccagggaagg
aaggagagtgcctcacgcctcgccgcctccactaataacaccttgtccggcaatcactgc
aatgtgaacgtcaacagcttggcaataccaataaacaaaaatgaaaagatgctccggtcg
cccacttcgccactctcagacacatgtaaacacaaatacgccagcgaggacctgacttct
tccagccgacctcacggcaacgggttgttgacttcagcgtcttccaacaaagagccaaag
gctgagagtcagctgcagacgattgctggggacctcacgaaggcatctcacaacagttct
gaaaatggcaccctccatagcaagtcacggccccagacggagccatggtctccaggttcc
aatggccacagggactgcaagagacagaaactgatcttcgatgacatgcctcgaagtgca
gattattttatgcgagaagccaagcggatgaaacataaagcagacgccatggtggagaag
ttcgggaaggccctgaactatgccgaagctgccttgtccttcatcgagtgcggaaacgca
atggaacaagggccaatggaatccaagtctccctacaccatgtactcggagacagtggag
ctcatcaggtatgctatgagactaaaaacccactcaggccccaatgccacaccagaggac
aaacagttagctgcgctttgttaccgatgcctggctctcctatactggcggatgtttcga
ctcaaaagagaccatgctgtaaaatattcaaaagcacttatcgactatttcaagaattca
tcgaaagctgcccaagccccatccccatgggggtccagtggcaagagcactggaagccca
tcccccatgtctcccaacccttctcccgccagctccgtggggtctcagggcagcctctcc
agctccagcggcctgtccccatcgaccatcgtcagcatcccccagcgcattcaccagatg
gcggccaatcacgtcagcatcaccaacagcatcctccacagctatgactactgggagatg
gctgataacctggccaaggaaaacagagagttcttcaatgacctggatttgctcatggga
cctgtcaccctgcacagcagcatggaacacctggtccagtactcccagcaaggcctgcat
tggcttcggagcagcgtacacctgtcctag

DBGET integrated database retrieval system