KEGG   Mus musculus (mouse): 16765
Entry
16765             CDS       T01002                                 

Gene name
Stmn1, 19k, L, La, Lag, Lap18, Op18, P18, P19, PP, PR, Pig, Pp17, Pp18, Pp19, Pr22, S, Smn, metab, op, p, p1
Definition
(RefSeq) stathmin 1
  KO
K04381  stathmin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16765 (Stmn1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    16765 (Stmn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Stathmin
     16765 (Stmn1)
SSDB
Motif
Pfam: Stathmin Ribonuc_2-5A Exonuc_VII_L
Other DBs
NCBI-GeneID: 16765
NCBI-ProteinID: NP_062615
MGI: 96739
Ensembl: ENSMUSG00000028832
Vega: OTTMUSG00000010830
UniProt: P54227 Q545B6
Position
4 D2.3; 4 66.76 cM
AA seq 149 aa
MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHVEEVRKNKESKDPADETEAD
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcatcttctgatattcaggtgaaagagctggagaagcgcgcttcaggccaggctttt
gagctgattctcagccctcggtcaaaagaatctgtccccgatttccccctttccccccca
aagaagaaggacctttccctggaggaaatccagaagaaattagaagctgcagaagaaaga
cgcaagtctcatgaggcggaagtcttgaagcagctcgcggagaagcgggagcatgagaag
gaggtgctccagaaagccatcgaggagaacaacaacttcagcaagatggcggaggagaag
ctgacccacaaaatggaggctaacaaagagaaccgggaggcgcagatggcggccaagctg
gagcgcttgcgagagaaggacaagcacgtggaagaggtgcggaagaacaaagaatccaaa
gaccccgcggatgagactgaggctgactaa

DBGET integrated database retrieval system